IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT human brain cDNA library PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT human brain cDNA library PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate. PloS one 2012 imex curation Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. Also in data-processing comment: From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt Accepted 2019-JUN-10 AT 09:28 BST AT 09:28 BST by MGT PloS one 2012 Only protein-protein interactions imex curation imex curation done; All bait/prey swapped. I have added the appropriate experiment, that I thought I had already curated... ;-) pp1a_rat Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Ppp1ca Ppp1a protein protein rat Rattus norvegicus (Rat) Rat MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK 60C37E1AD9831DAC p36873-2 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Protein phosphatase 1C catalytic subunit PPP1CC Gamma-2 PPPCC2 protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE 9731E5A6C8EEBF46 nek2_human Serine/threonine-protein kinase Nek2 NEK2A NimA-like protein kinase 1 HSPK 21 NEK2 NLK1 Never in mitosis A-related kinase 2 protein protein human Homo sapiens Human MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR D33A37778ABB6D9E toip1_rat Torsin-1A-interacting protein 1 Tor1aip1 Lamina-associated polypeptide 1B Lamina-associated polypeptide 1C protein protein rat Rattus norvegicus (Rat) Rat MAGERWRAEGLGEGWAIYVTPRAPIREGRRRLATQNGDGSDAPAYETHPSRHGRREVRFSEEPPEVYGDFEPRAAKERSPGERRTPPEKFRSDSAKEEVRESAYNLRSRQRRQRGPQEAEEMKTRRSTRLEQHSQQAQQQLSPATSGRGLRDAQSLSEDRGEDEPSSQPVTSQTVSKKTVRTPETSVMSEDPISNLCRPPLRSPRPDASIVQHINPFEEGETEDDLESSYSDVTIRIRSRDSVESRDEAAVAAGHHPDSLWGLPHSRGDFTAHENQPSLLPTGCQKNPQEWVEQAVRMRTRMAYNNIQKSDFGNQSPSTSRQQAAVQPPDESSVKIKWWLLILVAALAMGIYWFFHTPVVETTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEQTLEASLGLKEIEEKVRDFLKVKFTSSDTANSYNHMDPDKLNGLWSRISHLVLPVQPENALKAGSCL DIP protein Q5PQX1 original sequence version: 77 q5jtv8-1 Torsin-1A-interacting protein 1 Lamin-associated protein 1B TOR1AIP1 LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL 3EE90CAAF49054FC p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD DIP protein P02340 original sequence version: 117 DIP protein P02340 original sequence version: 165 DIP protein P02340 original sequence version: 187 DIP protein P02340 original sequence version: 201 DIP protein P02340 original sequence version: 111 DIP protein P02340 original sequence version: 141 DIP protein P02340 original sequence version: 180 DIP protein P02340 original sequence version: 163 DIP protein P02340 original sequence version: 152 ED5A607378D921D7 pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK DIP protein P62136 original sequence version: 72 DIP protein P62136 original sequence version: 76 DIP protein P62136 original sequence version: 123 DIP protein P62136 original sequence version: 126 DIP protein P62136-1 original sequence version: 98 60C37E1AD9831DAC p36873-1 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit Gamma-1 PPPCC1 protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK 0EEEF0E842188536 toip1_human Torsin-1A-interacting protein 1 TOR1AIP1 Lamin-associated protein 1B LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL DIP protein Q5JTV8 original sequence version: 61 3EE90CAAF49054FC pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK DIP protein P36873 original sequence version: 169 DIP protein P36873 original sequence version: 177 0EEEF0E842188536 lt_sv40 Large T antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET 3E37D4BAFC5D59BD q5jtv8-3 Torsin-1A-interacting protein 1 Lamin-associated protein 1B TOR1AIP1 LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPAVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL No experimental confirmation available. D5BEACC6B305B89B pp1a_chlae_protein Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P62136 pp1g_rat Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Ppp1cc Protein phosphatase 1C catalytic subunit protein protein rat Rattus norvegicus (Rat) Rat MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK 4E28412C16898615 toip1_chlae_protein Torsin-1A-interacting protein 1 TOR1AIP1 LAP1 LAP1B protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to Q5JTV8 pp1g_chlae_protein Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P36873 pp1a-lap1b-1 6 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.3A ppp1ca-tor1aip1-1 6 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.3 A-B ppp1cc-tor1aip1-1 6 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 3A ppp1cc-tor1aip1-2 1 16 unspecified role unspecified role bait bait purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 20 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 tor1aip1-ppp1cc-1 1 16 unspecified role unspecified role bait bait purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 positive control ppp1ca-tor1aip1-2 7 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table S2 Detailed analysis revealed 14, 4 and 2 positive clones, encoding a potentially novel PP1 regulatory protein - LAP1B, for the PP1α, PP1γ1 and PP1γ2 screens, respectively (Table S2) [32]. Sequencing of the identified clones determined that all correspond to the LAP1B variant 1, recently reported in the GenBank database (NM_001267578.1). ppp1cc-tor1aip1-3 7 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table S2 Detailed analysis revealed 14, 4 and 2 positive clones, encoding a potentially novel PP1 regulatory protein - LAP1B, for the PP1α, PP1γ1 and PP1γ2 screens, respectively (Table S2) [32]. Sequencing of the identified clones determined that all correspond to the LAP1B variant 1, recently reported in the GenBank database (NM_001267578.1). ppp1cc-tor1aip1-4 7 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table S2 Detailed analysis revealed 14, 4 and 2 positive clones, encoding a potentially novel PP1 regulatory protein - LAP1B, for the PP1α, PP1γ1 and PP1γ2 screens, respectively (Table S2) [32]. Sequencing of the identified clones determined that all correspond to the LAP1B variant 1, recently reported in the GenBank database (NM_001267578.1). pp1g-lap1b-1 8 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 6B, E Despite the quite different subcellular distribution of LAP1B and PP1 isoforms it is evident that they co-localize at specific points within the nucleus and very near to the nuclear envelope ppp1cc-tor1aip1-5 5 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 24 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3B ppp1cc-tor1aip1-6 5 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3B ppp1cc-tor1aip1-7 3 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3C ppp1ca-tor1aip1-3 3 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3C pp1g-lap1-1 2 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.4D ppp1cc-tor1aip1-8 2 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.4D ppp1ca-tor1aip1-4 2 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig.4D tor1aip1-ppp1cc-2 1 16 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 20 unspecified role unspecified role bait bait cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 5 As expected both LAP1B variants are able to interact with PP1gamma1 ppp1cc-tor1aip1-9 1 16 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 13 unspecified role unspecified role bait bait cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 5 As expected both LAP1B variants are able to interact with PP1gamma1 ppp1cc-tor1aip1-10 8 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 6B, E Despite the quite different subcellular distribution of LAP1B and PP1 isoforms it is evident that they co-localize at specific points within the nucleus and very near to the nuclear envelope ppp1ca-tor1aip1-5 6 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.3C positive control ppp1cc-tor1aip1-11 4 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4A