IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Nature communications 2012 imex curation Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. Accepted 2019-JUL-16 AT 07:50 BST AT 07:50 BST by ORCHARD Nature communications 2012 Only protein-protein interactions imex curation imex curation altered Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Nature communications 2012 imex curation Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-cerebral_cortical_neuron Mouse cerebral cortical neuron brain-cortex_neuron Cerebral cortical neuron pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. Accepted 2019-JUL-16 AT 07:50 BST AT 07:50 BST by ORCHARD Nature communications 2012 Only protein-protein interactions imex curation imex curation altered Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Septins promote dendrite and axon development by negatively regulating microtubule stability via HDAC6-mediated deacetylation. Nature communications 2012 imex curation Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-cerebral_cortical_neuron Mouse cerebral cortical neuron brain-cortex_neuron Cerebral cortical neuron anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ageta-Ishihara N., Miyata T., Ohshima C., Watanabe M., Sato Y., Hamamura Y., Higashiyama T., Mazitschek R., Bito H., Kinoshita M. Results from figure 5D have not been entered as the species origins of Sept7 are ambiguous. The stated reference (50) does not mention the origin of Sept7, Ref 15 is Rattine and Ref. 9 is Human (based on length of molecule). The authors did not reply to a request for information. kinoshita.makoto@c.mbox.nagoya-u.ac.jp The email address given in this publication did not exist;another one was located from other publications by this author. Accepted 2019-JUL-16 AT 07:50 BST AT 07:50 BST by ORCHARD Nature communications 2012 Only protein-protein interactions imex curation imex curation altered sept7_human Septin-7 SEPTIN7 CDC10 CDC10 protein homolog SEPT7 protein protein human Homo sapiens Human MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF DIP protein Q16181 original sequence version: 122 DIP protein Q16181 original sequence version: 130 946A08C54B7124FF sept7_mouse Septin-7 Septin7 CDC10 protein homolog Cdc10 Sept7 protein protein mouse Mus musculus Mouse MSVSARSAAAEERSVNCGTMAQPKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQNSSRTLEKNKKKGKIF 1028CCF14023059C hdac6_mouse Histone deacetylase 6 Histone deacetylase mHDA2 Hdac6 Tubulin-lysine deacetylase HDAC6 protein protein mouse Mus musculus Mouse MTSTGQDSSTRQRKSRHNPQSPLQESSATLKRGGKKCAVPHSSPNLAEVKKKGKMKKLSQPAEEDLVVGLQGLDLNPETRVPVGTGLVFDEQLNDFHCLWDDSFPESPERLHAIREQLILEGLLGRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLAETYDSVYLHPNSYSCACLATGSVLRLVDALMGAEIRNGMAVIRPPGHHAQHNLMDGYCMFNHLAVAARYAQKKHRIQRVLIVDWDVHHGQGTQFIFDQDPSVLYFSIHRYEHGRFWPHLKASNWSTIGFGQGQGYTINVPWNQTGMRDADYIAAFLHILLPVASEFQPQLVLVAAGFDALHGDPKGEMAATPAGFAHLTHLLMGLAGGKLILSLEGGYNLRALAKGVSASLHTLLGDPCPMLESCVVPCASAQTSIYCTLEALEPFWEVLERSVETQEEDEVEEAVLEEEEEEGGWEATALPMDTWPLLQNRTGLVYDEKMMSHCNLWDNHHPETPQRILRIMCHLEEVGLAARCLILPARPALDSELLTCHSAEYVEHLRTTEKMKTRDLHREGANFDSIYICPSTFACAKLATGAACRLVEAVLSGEVLNGIAVVRPPGHHAEPNAACGFCFFNSVAVAARHAQIIAGRALRILIVDWDVHHGNGTQHIFEDDPSVLYVSLHRYDRGTFFPMGDEGASSQVGRDAGIGFTVNVPWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLISAGFDAAQGDPLGGCQVTPEGYAHLTHLLMGLAGGRIILILEGGYNLASISESMAACTHSLLGDPPPQLTLLRPPQSGALVSISEVIQVHRKYWRSLRLMKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDVFYAVTPLSWCPHLMAVCPIPAAGLDVSQPCKTCGTVQENWVCLTCYQVYCSRYVNAHMVCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDMPHSH DIP protein Q9Z2V5 original sequence version: 131 D5F73BA3F79AF520 sept5_mouse Septin-5 Septin5 Cell division control-related protein 1 Peanut-like protein 1 Pnutl1 Sept5 protein protein mouse Mus musculus Mouse MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQKMKQQMQDQ D58468DBA9ADE626 hdac6_human Histone deacetylase 6 HDAC6 KIAA0901 JM21 Tubulin-lysine deacetylase HDAC6 protein protein human Homo sapiens Human MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH 6F17731268A33114 sept6_mouse Septin-6 Septin6 Kiaa0128 Sept6 protein protein mouse Mus musculus Mouse MAAADIARQVGEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMNAHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCIE 33DCD4F44607168A sep11_mouse Septin-11 Septin11 D5Ertd606e Sept11 protein protein mouse Mus musculus Mouse MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNPWLCTE CC838B791729B511 sept6_human Septin-6 SEPTIN6 KIAA0128 SEP2 SEPT6 protein protein human Homo sapiens Human MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE DIP protein Q14141 original sequence version: 120 DIP protein Q14141 original sequence version: 152 DIP protein Q14141 original sequence version: 128 E684AE6A93B32362 sept2_mouse Septin-2 Sept2 Septin2 Nedd5 Neural precursor cell expressed developmentally down-regulated protein 5 protein protein mouse Mus musculus Mouse MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDSDSGALGQHV DIP protein P42208 original sequence version: 95 DIP protein P42208 original sequence version: 126 C4BFFB3F1815E081 sept7-sept11-1 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supplementary figure 1 sept7-hdac6-1 3 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 5C hdac6-sept7-1 3 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 5C sept2-hdac6-1 1 8 unspecified role unspecified role prey prey purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role ancillary ancillary purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 4 unspecified role unspecified role ancillary ancillary purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 12 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Figure 5E it is not clear from Ref 27 if Sept6 is also His-tagged. As it is not clear which mol HDAC6 is interacting with maybe this interaction should not be included? the roles of Sept7/6 could be "Ancillary" rather than co-factor? hdac6-sept7-2 2 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 5F