IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Dopamine D2 receptor signaling dynamics of dopamine D2-neurotensin 1 receptor heteromers. Dopamine D2 receptor signaling dynamics of dopamine D2-neurotensin 1 receptor heteromers. Biochemical and biophysical research communications 2013 imex curation Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K., Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K. not DSP - but looks important interaction? cannot access supplement-but from text I dont think I have missed any interactions? The species of origin of the dopamine D2 receptor was found to be Human, by tracing references back to pmid:19344374 and subsequent Blat of 5' primer. kjell.Fuxe@ki.se 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K., Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K. not DSP - but looks important interaction? cannot access supplement-but from text I dont think I have missed any interactions? The species of origin of the dopamine D2 receptor was found to be Human, by tracing references back to pmid:19344374 and subsequent Blat of 5' primer. kjell.Fuxe@ki.se Accepted 2019-SEP-19 AT 08:56 BST AT 08:56 BST by PPORRAS Biochemical and biophysical research communications 2013 Only protein-protein interactions imex curation imex curation Dopamine D2 receptor signaling dynamics of dopamine D2-neurotensin 1 receptor heteromers. Dopamine D2 receptor signaling dynamics of dopamine D2-neurotensin 1 receptor heteromers. Biochemical and biophysical research communications 2013 imex curation Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K., Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K. not DSP - but looks important interaction? cannot access supplement-but from text I dont think I have missed any interactions? The species of origin of the dopamine D2 receptor was found to be Human, by tracing references back to pmid:19344374 and subsequent Blat of 5' primer. kjell.Fuxe@ki.se 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K., Borroto-Escuela DO., Ravani A., Tarakanov AO., Brito I., Narvaez M., Romero-Fernandez W., Corrales F., Agnati LF., Tanganelli S., Ferraro L., Fuxe K. not DSP - but looks important interaction? cannot access supplement-but from text I dont think I have missed any interactions? The species of origin of the dopamine D2 receptor was found to be Human, by tracing references back to pmid:19344374 and subsequent Blat of 5' primer. kjell.Fuxe@ki.se Accepted 2019-SEP-19 AT 08:56 BST AT 08:56 BST by PPORRAS Biochemical and biophysical research communications 2013 Only protein-protein interactions imex curation imex curation p14416-2 D(2) dopamine receptor Dopamine D2 receptor D2(Short) DRD2 D2B protein protein human Homo sapiens Human MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC BFC25AC601DFDC7F ntr1_human Neurotensin receptor type 1 NTSR1 NTRR High-affinity levocabastine-insensitive neurotensin receptor NTRH protein protein human Homo sapiens Human MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY DIP protein P30989 original sequence version: 136 471AD1C49D29C2C8 drd2_human D(2) dopamine receptor DRD2 Dopamine D2 receptor protein protein human Homo sapiens Human MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 9BF8EA36C988A2E2 drd2-ntsr1-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supplementary Fig. 1 drd2-ntsr1-2 1 4 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1A drd2-ntsr1-3 1 4 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1A-2 NTS1R directly and specifically interacts with both D 2L R and D 2S R drd2-ntsr1-4 1 4 competitor competitor competitor unspecified role unspecified role over-expressed over expressed level over-expressed 4 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-1 drd2-ntsr1-5 1 3 competitor competitor competitor unspecified role unspecified role over-expressed over expressed level over-expressed 4 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-2 drd2-ntsr1-6 1 4 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 competitor competitor competitor unspecified role unspecified role over-expressed over expressed level over-expressed 5 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-3