IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of sperm head proteins involved in zona pellucida binding. Identification of sperm head proteins involved in zona pellucida binding. Human reproduction (Oxford, England) 2013 imex curation Petit FM., Serres C., Bourgeon F., Pineau C., Auer J. The Harris reference gives these aas for the ZP proteins:- ZPA (ZP2)= 39-638, ZPB(ZP4) =19-463, ZPC(ZP3) =23-383. However although this is a such an old publication the sequences have not been substantially updated, and are all the same length as date of publication- the ZPC/ZP3 protein is the longest (canonical) isoform as others are too short. found while searching for DSP protein GPX4; this protein IS in this publication but also several ZP proteins in this pub. have no CC line entry. Recombinant human zona pellucida (rhZP) proteins (minus the N-terminal leader and the C-terminal transmembrane-like domain) are used in this publication. The domain numbering has been taken from the Harris 1999 reference (PMID:10419825). jana.auer@parisdescartes.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Petit FM., Serres C., Bourgeon F., Pineau C., Auer J. The Harris reference gives these aas for the ZP proteins:- ZPA (ZP2)= 39-638, ZPB(ZP4) =19-463, ZPC(ZP3) =23-383. However although this is a such an old publication the sequences have not been substantially updated, and are all the same length as date of publication- the ZPC/ZP3 protein is the longest (canonical) isoform as others are too short. Recombinant human zona pellucida (rhZP) proteins (minus the N-terminal leader and the C-terminal transmembrane-like domain) are used in this publication. The domain numbering has been taken from the Harris 1999 reference (PMID:10419825). jana.auer@parisdescartes.fr Accepted 2019-APR-08 AT 11:32 BST AT 11:32 BST by LIVIAP Human reproduction (Oxford, England) 2013 Only protein-protein interactions imex curation imex curation altered, as suggested. Identification of sperm head proteins involved in zona pellucida binding. Identification of sperm head proteins involved in zona pellucida binding. Human reproduction (Oxford, England) 2013 imex curation Petit FM., Serres C., Bourgeon F., Pineau C., Auer J. The Harris reference gives these aas for the ZP proteins:- ZPA (ZP2)= 39-638, ZPB(ZP4) =19-463, ZPC(ZP3) =23-383. However although this is a such an old publication the sequences have not been substantially updated, and are all the same length as date of publication- the ZPC/ZP3 protein is the longest (canonical) isoform as others are too short. found while searching for DSP protein GPX4; this protein IS in this publication but also several ZP proteins in this pub. have no CC line entry. Recombinant human zona pellucida (rhZP) proteins (minus the N-terminal leader and the C-terminal transmembrane-like domain) are used in this publication. The domain numbering has been taken from the Harris 1999 reference (PMID:10419825). jana.auer@parisdescartes.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting sequence tag sequence tag identification sequence tag Petit FM., Serres C., Bourgeon F., Pineau C., Auer J. The Harris reference gives these aas for the ZP proteins:- ZPA (ZP2)= 39-638, ZPB(ZP4) =19-463, ZPC(ZP3) =23-383. However although this is a such an old publication the sequences have not been substantially updated, and are all the same length as date of publication- the ZPC/ZP3 protein is the longest (canonical) isoform as others are too short. Sperm membrane proteins were fractionated using ID or 2D gel electrophoresis. Glycoproteins that interacted with sperm proteins were detected with specific anti-rhZP sera. Matching silver stained spots from Figures 1 (Far Western) and Figure 3 (2D preparative gel of sperm proteins) were excised from preparative gel and analysed by MS. Recombinant human zona pellucida (rhZP) proteins (minus the N-terminal leader and the C-terminal transmembrane-like domain) are used in this publication. The domain numbering has been taken from the Harris 1999 reference (PMID:10419825). jana.auer@parisdescartes.fr Accepted 2019-APR-08 AT 11:32 BST AT 11:32 BST by LIVIAP Human reproduction (Oxford, England) 2013 Only protein-protein interactions imex curation imex curation altered, as suggested. zp2_human Zona pellucida sperm-binding protein 2 ZP2 ZPA Zona pellucida glycoprotein 2 Zona pellucida protein A protein protein human Homo sapiens Human MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSGNSIDVSQLVNPAFPGTVTCDEREITVEFPSSPGTKKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPGQKVIFSSQAICAPDPVTCNATHMTLTIPEFPGKLKSVSFENQNIDVSQLHDNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETVSMVIYPECLCESPVSIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVSEAHVLSSLVYFHCSALICNRLSPDSPLCSVTCPVSSRHRRATGATEAEKMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH 2614DA79738F2CDD q5bjf6-5 Outer dense fiber protein 2 ODF2 Cenexin Outer dense fiber of sperm tails protein 2 Cenexin 1 ODF2/1 protein protein human Homo sapiens Human MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRVRDWQKGSHELTRAGARIPR Major. mint B7625F274EDB1EAB gstm3_human Glutathione S-transferase Mu 3 GSTM3 GST5 GSTM3-3 GST class-mu 3 protein protein human Homo sapiens Human MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC 79093161ECEF5396 zp3_human Zona pellucida sperm-binding protein 3 ZP3 ZP3A ZP3B ZPC Sperm receptor ZP3A/ZP3B Zona pellucida glycoprotein 3 Zona pellucida protein C protein protein human Homo sapiens Human MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPVSASE 0F3CCDA2427C0E3A p60174-1 Triosephosphate isomerase TPI1 TPI Triose-phosphate isomerase Methylglyoxal synthase protein protein human Homo sapiens Human MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ 73844175635F858E g3pt_human Glyceraldehyde-3-phosphate dehydrogenase, testis-specific GAPDHS GAPD2 GAPDH2 GAPDS HSD35 HSD-35 Spermatogenic glyceraldehyde-3-phosphate dehydrogenase Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2 protein protein human Homo sapiens Human MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK 301F71C768CD95D8 gpx4_human Phospholipid hydroperoxide glutathione peroxidase GPX4 Glutathione peroxidase 4 protein protein human Homo sapiens Human MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF 1AE3BC7AE42FDDB1 enoa_human Alpha-enolase ENO1 ENO1L1 MBPB1 MPB1 2-phospho-D-glycerate hydro-lyase Non-neural enolase Enolase 1 Phosphopyruvate hydratase C-myc promoter-binding protein MBP-1 MPB-1 Plasminogen-binding protein protein protein human Homo sapiens Human MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK DIP protein P06733 original sequence version: null A0ED663FCC15ADA5 aldoa_human Fructose-bisphosphate aldolase A Muscle-type aldolase Lung cancer antigen NY-LU-1 ALDOA ALDA protein protein human Homo sapiens Human MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY DIP protein P04075 original sequence version: null 0AAED80F755A7BE8 p45880-3 Voltage-dependent anion-selective channel protein 2 VDAC2 Outer mitochondrial membrane protein porin 2 protein protein human Homo sapiens Human MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA F4EAE732E653637E zp4_human Zona pellucida sperm-binding protein 4 ZP4 ZPB Zona pellucida glycoprotein 4 Zona pellucida protein B protein protein human Homo sapiens Human MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPARDRLPCAPSPISRGDCEGLGCCYSSEEVNSCYYGNTVTLHCTREGHFSIAVSRNVTSPPLLLDSVRLALRNDSACNPVMATQAFVLFQFPFTSCGTTRQITGDRAVYENELVATRDVKNGSRGSVTRDSIFRLHVSCSYSVSSNSLPINVQVFTLPPPFPETQPGPLTLELQIAKDKNYGSYYGVGDYPVVKLLRDPIYVEVSILHRTDPYLGLLLQQCWATPSTDPLSQPQWPILVKGCPYIGDNYQTQLIPVQKALDLPFPSHHQRFSIFTFSFVNPTVEKQALRGPVHLHCSVSVCQPAETPSCVVTCPDLSRRRNFDNSSQNTTASVSSKGPMILLQATKDPPEKLRVPVDSKVLWVAGLSGTLILGALLVSYLAVKKQKSCPDQMCQ 9DAC310D808E1AC3 p14618-2 Pyruvate kinase PKM M1-PK PKM1 PKM OIP3 PK2 PK3 PKM2 Cytosolic thyroid hormone-binding protein Opa-interacting protein 3 Pyruvate kinase 2/3 Pyruvate kinase muscle isozyme Thyroid hormone-binding protein 1 Tumor M2-PK p58 protein protein human Homo sapiens Human MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP AB9B5B2308D26B79 zp2-pkm-2 2 14 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-1 zp2-pkm-1 2 10 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-2 zp2-eno1-1 2 8 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-3 zp2-gapdhs-1 2 9 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-4 zp2-gpx4-1 2 12 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-5 zp3-vdac2-1 2 12 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-6 zp3-vdac2-2 2 4 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-7 zp3-odf2-1 2 7 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-8 zp3-tpi1-1 2 5 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-9 zp3-gapdhs-1 2 8 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-10 zp3-gapdhs-2 2 9 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-11 zp3-gpx4-1 2 14 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-12 zp3-pkm-1 2 10 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-13 zp3-eno1-1 2 10 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-14 zp4-eno1-1 2 8 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-15 zp4-gapdhs-1 2 9 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-16 zp4-gpx4-1 2 14 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-17 zp4-pkm-1 2 11 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-18 zp4-tpi1-1 2 7 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-19 zp4-tpi1-2 2 5 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-20 zp4-gstm3-1 2 4 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 1, Figure 3, Table 1-21 zp4-gstm3-2 1 5 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-sperm Homo sapiens - sperm sperm 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 4A GSTM preferentially co-precipitated with rhZP4 when compared with rhZP2 and rhZP3 (Fig.4A). from the text it is not clear if there is meant to be a band/positive result for ZP2 and ZP3 - so have omitted. zp2-vdac2-1 1 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-sperm Homo sapiens - sperm sperm 3 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 5A-Lane A zp3-vdac2-3 1 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-sperm Homo sapiens - sperm sperm 6 unspecified role unspecified role bait bait purified purified ecd_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Figure 5A-Lane C