IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. no species origin given for any control proteins nor any N/C terminal Tag locations that I can find.-however Tags are not added as these are implicit in the method, apart from HA tag which is not relevant here. beta catenin primers map to more than one species. cd63 has no Myth primers given in Table S4 at all. The Prey is fused to NubG which has a glycine to Isoleucine mutation at residue 13. (This reduces spontaneous reassociation with Cub when both are expressed.) CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Regulation of CD133 by HDAC6 promotes β-catenin signaling to suppress cancer cell differentiation. Cell reports 2012 imex curation Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Accepted 2019-JUL-23 AT 08:06 BST AT 08:06 BST by LIVIAP adult human kidney Cell reports 2012 Only protein-protein interactions imex curation imex curation added; added back CD133 without any isoform info; the Deribe -2009 does not mention any of the stated constructs;the reverse primer does not Blat or Blast to anything, and gave up on "Translate".; Already comments there as to why these have not been entered. tm165_human Transmembrane protein 165 TMEM165 TPARL Transmembrane protein PT27 Transmembrane protein TPARL protein protein human Homo sapiens Human MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSGF A0E6C8BBFF189D72 ifm1_human Interferon-induced transmembrane protein 1 IFITM1 IFI17 Interferon-inducible protein 9-27 Interferon-induced protein 17 Leu-13 antigen CD225 Dispanin subfamily A member 2a protein protein human Homo sapiens Human MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY 10EE5B64894838ED yipf6_human Protein YIPF6 YIP1 family member 6 YIPF6 protein protein human Homo sapiens Human MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ 2BAF422A0EF286AD cc167_human Coiled-coil domain-containing protein 167 CCDC167 C6orf129 HSPC265 protein protein human Homo sapiens Human MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM 8B68E89EFEEB782C ghitm_human Growth hormone-inducible transmembrane protein GHITM DERP2 MICS1 TMBIM5 Dermal papilla-derived protein 2 Mitochondrial morphology and cristae structure 1 Transmembrane BAX inhibitor motif-containing protein 5 My021 UNQ244/PRO281 protein protein human Homo sapiens Human MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK 808FAED86A9CD98E spcs1_human Signal peptidase complex subunit 1 SPCS1 SPC12 Microsomal signal peptidase 12 kDa subunit HSPC033 protein protein human Homo sapiens Human MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN 65F180938A9BEF1E q9buf7-2 Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 B protein protein human Homo sapiens Human MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI ccd63_human Coiled-coil domain-containing protein 63 CCDC63 protein protein human Homo sapiens Human MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQYKEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAELDEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQAKREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEVEGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPFSDRLDDVEQPLDHSSLRQLVLDNYILKENRSKEVRGDSLPEKVDDFRSRKKVTM o95490-2 Adhesion G protein-coupled receptor L2 Calcium-independent alpha-latrotoxin receptor 2 Latrophilin homolog 1 Latrophilin-2 Lectomedin-1 Lectomedin-1 gamma ADGRL2 KIAA0786 LEC1 LPHH1 LPHN2 protein protein human Homo sapiens Human MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTYKYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRTDTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEATWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPNQYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIISTTSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWPQTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAASLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIYRSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYAIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMPNLRDSPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL CE43AB82916D0D35 ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E at5g3_human ATP synthase F(0) complex subunit C3, mitochondrial ATP5MC3 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 3 ATP synthase proteolipid P3 ATP synthase proton-transporting mitochondrial F(0) complex subunit C3 ATP5G3 ATPase protein 9 ATPase subunit c protein protein human Homo sapiens Human MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM 19EC0D1710A0AA3F bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE D34367F870D6EB00 ccl2_human C-C motif chemokine 2 CCL2 MCP1 SCYA2 Small-inducible cytokine A2 Monocyte chemoattractant protein 1 Monocyte chemotactic protein 1 Monocyte chemotactic and activating factor Monocyte secretory protein JE HC11 protein protein human Homo sapiens Human MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT DIP protein P13500 original sequence version: 191 45EC72361435302F cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 85AC8E235C6E425F serp1_human Stress-associated endoplasmic reticulum protein 1 SERP1 RAMP4 Ribosome-attached membrane protein 4 protein protein human Homo sapiens Human MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM DC15C0143AAE0D91 prom1_human Prominin-1 PROM1 PROML1 Antigen AC133 Prominin-like protein 1 MSTP061 protein protein human Homo sapiens Human MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH D21CBC05ADB2DEDF aif1l_human Allograft inflammatory factor 1-like UNQ672/PRO1306 AIF1L C9orf58 IBA2 Ionized calcium-binding adapter molecule 2 protein protein human Homo sapiens Human MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP 74614436B9DEB5F6 q8n6l1-2 Keratinocyte-associated protein 2 KRTCAP2 KCP2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 protein protein human Homo sapiens Human MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN Produced at low levels due to suboptimal Kozak context. 4351A6485FA2CC75 cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE DIP protein O95715 original sequence version: 128 C9A18B2A78CACF74 hdac6_human Histone deacetylase 6 HDAC6 KIAA0901 JM21 Tubulin-lysine deacetylase HDAC6 protein protein human Homo sapiens Human MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH 6F17731268A33114 plp2_human Proteolipid protein 2 Intestinal membrane A4 protein Differentiation-dependent protein A4 PLP2 A4 protein protein human Homo sapiens Human MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV 689378A8C326206C o43490-2 Prominin-1 PROM1 PROML1 Antigen AC133 Prominin-like protein 1 MSTP061 AC133-2 S1 protein protein human Homo sapiens Human MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH DFF0B7AFE0A02582 vkor1_human Vitamin K epoxide reductase complex subunit 1 VKORC1 VKOR Vitamin K1 2,3-epoxide reductase subunit 1 MSTP134 MSTP576 UNQ308/PRO351 protein protein human Homo sapiens Human MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH 2F00526A6C561D5A q8ni32-2 Ly6/PLAUR domain-containing protein 6B LYPD6B protein protein human Homo sapiens Human MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL No experimental confirmation available. 6F760FFC205B8822 cln5_human Ceroid-lipofuscinosis neuronal protein 5 CLN5 protein protein human Homo sapiens Human MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL 07E49D4913685190 elov5_human Elongation of very long chain fatty acids protein 5 Very long chain 3-ketoacyl-CoA synthase 5 Very long chain 3-oxoacyl-CoA synthase 5 PRO0530 ELOVL5 3-keto acyl-CoA synthase ELOVL5 ELOVL fatty acid elongase 5 ELOVL2 Fatty acid elongase 1 protein protein human Homo sapiens Human MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD AE5150AA3432E984 ifm3_human Interferon-induced transmembrane protein 3 IFITM3 Dispanin subfamily A member 2b Interferon-inducible protein 1-8U protein protein human Homo sapiens Human MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG mint 9FFB2E4623F7A1DD cyb5_human Cytochrome b5 CYB5A CYB5 Microsomal cytochrome b5 type A protein protein human Homo sapiens Human MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED B6AD2AB747555048 tm230_human Transmembrane protein 230 TMEM230 C20orf30 HSPC274 UNQ2432/PRO4992 protein protein human Homo sapiens Human MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD 18A4A556330D77CE itm2b_human Integral membrane protein 2B ITM2B BRI BRI2 Protein E25B Transmembrane protein BRI Immature BRI2 protein protein human Homo sapiens Human MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS 3A7D8CA259F1F627 prom1-hdac6-1 4 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table S1 prom1-hdac6-2 1 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supplementary Figure 1A hdac6-ctnnb1-1 1 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supplementary Figure 1A, figure 6A prom1-hdac6-3 3 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1A/B prom1-hdac6-4 3 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UBN7:p.Ser568Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 16:59:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser568Glu' region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q9UBN7:p.Ser568Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:27:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser568Ala' Q9UBN7:p.Tyr570Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y E Tue Jun 30 19:18:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr570Glu' Q9UBN7:p.Tyr570Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 19:46:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr570Ala' Q9UBN7:p.[His216Ala;His611Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain H A Wed Sep 18 13:39:31 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His216Al;His611Ala]' Tue Jun 30 20:04:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His216Ala;His611Ala]' physical association physical association Figure 1C/D I think the tags are probably N-terminal here, but in the absence of any info on this I have left as ?-? Similarly no info is given on sequence length of HDAC6 constructs used, so I have just entered the Required to Bind region. apbb1-hdac6-1 5 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 1E, Supplementary Figure 1C hdac6-ctnnb1-2 1 16 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 6A 2343242-1 2 16 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Supplementary figure 6A A striking colocalization of CD133 and beta-catenin ( Pearson’s correlation = 0.82) was found. By contrast, only a small fraction of HDAC6 colocalized with CD133 and beta-catenin. apbb1-hdac6-2 6 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -1 apbb1-yipf6-1 6 34 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -2 apbb1-yipf6-2 6 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -3 apbb1-yipf6-3 6 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -4 apbb1-yipf6-4 6 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -5 apbb1-yipf6-5 6 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -6 apbb1-yipf6-6 6 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -7 apbb1-yipf6-7 6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -8 apbb1-yipf6-8 6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -9 apbb1-yipf6-9 6 23 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -10 apbb1-yipf6-10 6 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -11 apbb1-yipf6-11 6 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -12 apbb1-yipf6-12 6 33 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -13 apbb1-yipf6-13 6 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -14 apbb1-yipf6-14 6 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -15 apbb1-yipf6-15 6 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -16 apbb1-yipf6-16 6 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -17 apbb1-yipf6-17 6 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -18 apbb1-yipf6-18 6 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -19 apbb1-yipf6-20 6 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -20 apbb1-yipf6-21 6 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -21 apbb1-yipf6-22 6 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -22 apbb1-yipf6-23 6 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -23 apbb1-yipf6-24 6 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 36 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -24 apbb1-yipf6-25 6 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 31 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Supplementary Table 2 -25 apbb1-ccdc63-1 2 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Figure 2E, supplementary figure 3D Tubacin -a HDAC6-specific small-molecule inhibitor Cells treated with HDAC6 shRNAs showed greater colocalisation.