IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Cellular signalling 2012 imex curation Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. tsmclyl@126.com,bbai@mail.jnmc.edu.cn 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. solubilized cell membranes tsmclyl@126.com,bbai@mail.jnmc.edu.cn Accepted 2019-AUG-09 AT 10:05 BST AT 10:05 BST by MARTA Cellular signalling 2012 Only protein-protein interactions imex curation imex curation Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Cellular signalling 2012 imex curation Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. tsmclyl@126.com,bbai@mail.jnmc.edu.cn 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. tsmclyl@126.com,bbai@mail.jnmc.edu.cn Accepted 2019-AUG-09 AT 10:05 BST AT 10:05 BST by MARTA Cellular signalling 2012 Only protein-protein interactions imex curation imex curation Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Heterodimerization of human apelin and kappa opioid receptors: roles in signal transduction. Cellular signalling 2012 imex curation Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. tsmclyl@126.com,bbai@mail.jnmc.edu.cn 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Li Y., Chen J., Bai B., Du H., Liu Y., Liu H. tsmclyl@126.com,bbai@mail.jnmc.edu.cn Accepted 2019-AUG-09 AT 10:05 BST AT 10:05 BST by MARTA Cellular signalling 2012 Only protein-protein interactions imex curation imex curation oprk_human Kappa-type opioid receptor OPRK1 OPRK protein protein human Homo sapiens Human MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV 3DA6E9F90FB48825 apj_human Apelin receptor APLNR AGTRL1 APJ Angiotensin receptor-like 1 G-protein coupled receptor APJ G-protein coupled receptor HG11 protein protein human Homo sapiens Human MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD 78DB18BEA6D2B2E4 aplnr-oprk1-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 1A aplnr-oprk1-2 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1B aplnr-oprk1-3 3 5 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2A/B/C please note use of term "PHOTON donor" rather than Fluorescence! apelin-13 and/or DynA(1-13) (Dynorphin A aas 207-219 of Human P01213)