IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. The sequence numbering for mouse positive clone sequence was calculated from the given corresponding human protein sequence (491-805 in human corresponds to 487-774 in mouse) patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT mouse cDNA library was used BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation Mouse Tacc1 ID corrected The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation new protein created for RARA - chlae The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR. BMC molecular biology 2010 imex curation Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. patrick.ravel-chapuis@ens-lyon.fr 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P. glucocorticoid receptor (GR) construct gifted by JM. Vanacker was found to be a mouse origin (by PMID: 9604929) patrick.ravel-chapuis@ens-lyon.fr Accepted 2019-SEP-27 AT 10:11 BST AT 10:11 BST by MGT BMC molecular biology 2010 Only protein-protein interactions imex curation imex curation rara_mouse Retinoic acid receptor alpha Rara Nr1b1 Nuclear receptor subfamily 1 group B member 1 protein protein mouse Mus musculus Mouse MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP DIP protein P11416 original sequence version: 140 726F7799633A85AD p63059-1 Thyroid hormone receptor alpha Nuclear receptor subfamily 1 group A member 1 c-erbA-1 c-erbA-alpha Thra C-erba-alpha Nr1a1 protein protein rat Rattus norvegicus (Rat) Rat MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQFGEAGSLRGPVLQHQSPKSPQQRLLELLHRSGILHSRAVCGEDDSSEASSLSSSSSDEDTEVFEDLAGKAASP Does not bind thyroid hormone T3. 0B0411F51F614A01 rara_chlae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey pparg_mouse Peroxisome proliferator-activated receptor gamma Pparg Nr1c3 Nuclear receptor subfamily 1 group C member 3 protein protein mouse Mus musculus Mouse MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY AB8F3F6086E2A10A gcr_mouse Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 Nr3c1 Grl Grl1 protein protein mouse Mus musculus Mouse MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQQQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK 528730BD2C517554 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 p18113-1 Thyroid hormone receptor beta Thrb Erba2 Nr1a2 Nuclear receptor subfamily 1 group A member 2 c-erbA-2 c-erbA-beta protein protein rat Rattus norvegicus (Rat) Rat MTPNSMTENRLPAWDKQKPHPDRGQDWKLVGMSEACLHRKSHVERRGALKNEQTSSHLIQATWASSIFHLDPDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGQVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED 16705C200E02995B tacc1_mouse Transforming acidic coiled-coil-containing protein 1 Tacc1 protein protein mouse Mus musculus Mouse MAFSPWQILSPVQWAKWTWSAVRGSGAGEDEAGGPEGDPEEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPLKESCDSSPGLAEPEAKPQESREADEQLVAEVIEKCSPDTCSRSSENEAPQATVDSHPVKDVRGKAEHDVSKISVVRPFSIETRNCTDDPAALGTAAAHGCVPVLPGMALPSTTPEATQDEPVMDRGMGVTLEAFTEASLKTGGPCPEPVASRSKLRKPKPVSLRKKMAPEPEMLMEGSPLPKASSPWLPDGLDQNANPSVLRGSGAQRSPLNLKETAGVLSNDTSDSGVEVAPGSPPLQLEDDFTEDGENVKIRSALPKQSGRKPSNKLAPSIRKDGVSKPVGVEQPSDPTVQDALLDQMSPKLDPSKRSHPPANFFGSGPILQNSPPLSSKCSHHFDPNNINTDDSGDPCKPTPALTSSGFCPATGNHVNEILDSPKKAKSRLITSGCKVKKYEAQPLDLDACSQDEGAVISKISEIPNRDGHATDEEKLASTSSCAQKSAGAGVKGIEKETCQKMEKEELAVHGLLESSSEKAPVSVACGGESPLDGICLSEADKTAVLTLIREEIITKEIEANEWKKKYEETREEVLEMRKIVAEYEKTIAQMIEDEQRTSMSSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKVHAEEKLDRANEEIAQVRSKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD AE9D412E63180976 rxra_mouse Retinoic acid receptor RXR-alpha Rxra Nr2b1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein mouse Mus musculus Mouse MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT 0AF62396BCDC87DB p63058-1 Thyroid hormone receptor alpha Nuclear receptor subfamily 1 group A member 1 c-erbA-1 c-erbA-alpha Thra C-erba-alpha Nr1a1 protein protein mouse Mus musculus Mouse MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLRGPVLQHQSPKSPQQRLLELLHRSGILHSRAVCGEDDSSEASSLSSSSDTEDTEVCEDQAGKAASP Does not bind thyroid hormone T3. 870100FCB5C34A10 o75410-9 Transforming acidic coiled-coil-containing protein 1 Gastric cancer antigen Ga55 Taxin-1 TACC1-K TACC1 KIAA1103 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPDNFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD No experimental confirmation available. 490071B11E774E0B o75410-10 Transforming acidic coiled-coil-containing protein 1 Gastric cancer antigen Ga55 Taxin-1 TACC1-J TACC1 KIAA1103 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD No experimental confirmation available. 15BECA70BAF4CEEE tacc1_human Transforming acidic coiled-coil-containing protein 1 Taxin-1 Gastric cancer antigen Ga55 TACC1 KIAA1103 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPDNFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD 3A261EF58C165107 p63059-2 Thyroid hormone receptor alpha Thra C-erba-alpha Nr1a1 Nuclear receptor subfamily 1 group A member 1 c-erbA-1 c-erbA-alpha protein protein rat Rattus norvegicus (Rat) Rat MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV EC0240EF1ECF4111 q6y685-2 Transforming acidic coiled-coil-containing protein 1 Tacc1 Short protein protein mouse Mus musculus Mouse MAFSPWQILSPVQWAKWTWSAVRGSGAGEDEAGGPEGDPEEEEDSQAETKSLSFRSGCKVKKYEAQPLDLDACSQDEGAVISKISEIPNRDGHATDEEKLASTSSCAQKSAGAGVKGIEKETCQKMEKEELAVHGLLESSSEKAPVSVACGGESPLDGICLSEADKTAVLTLIREEIITKEIEANEWKKKYEETREEVLEMRKIVAEYEKTIAQMIEDEQRTSMSSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKVHAEEKLDRANEEIAQVRSKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD 9F44CC06F0DC8042 p63058-2 Thyroid hormone receptor alpha Thra C-erba-alpha Nr1a1 Nuclear receptor subfamily 1 group A member 1 c-erbA-1 c-erbA-alpha protein protein mouse Mus musculus Mouse MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV EC0240EF1ECF4111 tacc1-thra-1 1 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind range range range range 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 1 tacc1-thra-2 3 18 unspecified role unspecified role bait bait partially purified partially purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Figure 2a tacc1-thra-3 3 20 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 18 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 2a weak interaction tacc1-thra-4 6 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75410-10:p.[Leu170Ala;Ile171Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain L A Wed Sep 18 12:36:30 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu171Ala;Ile172Ala]' Tue Jun 30 18:43:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu170Ala;Ile171Ala]' physical association physical association Figures 2b, 2c and 3a Thyroid hormone, T3 A truncated form of TRalpha1 was less affected by the presence of T3. tacc1-thrb-1 6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 2b Thyroid hormone, T3 tacc1-thra-5 6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 2b Thyroid hormone, T3, was not able to inhibit the interaction rara-tacc1-1 4 7 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 4a tacc1-thra-6 2 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Additional file 1 Thyroid hormone (T3 10^-7M) tacc1-thra-7 2 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Additional file 1 Thyroid hormone (T3 10^-7M) rara-tacc1-2 6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Additional file 2a All-trans retinoic acid (5x10^-7 M) pparg-tacc1-1 6 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Additional file 2b Rosiglitazon (10^-7 M) esr1-tacc1-1 6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Additional file 2c Estradiol (10^-7 M) nr3c1-tacc1-1 6 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Additional file 2e Dexamethasone (10^-7 M & 10^-6 M) rara-tacc1-3 5 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 19 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Additional file 3 UniProt does have RARA protein annotated for chlae; new interactor had been created with human RARA protein id as "see-also" thra-tacc1-3 6 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75410-9:p.[Leu580Ala;Ile581Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 18:56:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu580Ala;Ile581Ala]' 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 3a thra-tacc1-4 6 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75410-9:p.[Leu580Ala;Ile581Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 15:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu580Ala;Ile581Ala]' 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 3a thra-tacc1-5 5 17 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75410-9:p.[Leu580Ala;Ile581Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 20:00:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu580Ala;Ile581Ala]' 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 3b rara-tacc1-4 6 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Additional file 2d 9 cis Retinoic Acid (10^-7 M and 10^-6 M)