IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Developmental cell 2008 imex curation Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells tap tandem affinity purification TAP TAP tap weight silver stain molecular weight estimation by silver staining weight silver stain Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 Figure 2G:RPE-[LAP-BBS4] cells were transfected with siRNA duplex and grown in the presence of media containing l-[35S]Methionine and l-[35S]Cysteine. The identity of the bands shown on a phosphorscreen was inferred from comparison with a silver-stained gel (Figure 1A). nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu Accepted 2019-JUL-16 AT 07:53 BST AT 07:53 BST by ORCHARD Developmental cell 2008 Only protein-protein interactions imex curation imex curation I have amalgamated the 3 Expts - 1,6,7 a la Lukasz. I have added the Exp. Mod. from Expt 6, which should have had the figure legend as 2G - but did not. I have added with Participant Detection as Autoradiography, rather than Predetermined as in Expt-6. Expt-7 deleted, but this Expt. left in to show correction comment as I cannot add this at publication level. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Developmental cell 2008 imex curation Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu Accepted 2019-JUL-16 AT 07:53 BST AT 07:53 BST by ORCHARD Developmental cell 2008 Only protein-protein interactions imex curation imex curation I have amalgamated the 3 Expts - 1,6,7 a la Lukasz. I have added the Exp. Mod. from Expt 6, which should have had the figure legend as 2G - but did not. I have added with Participant Detection as Autoradiography, rather than Predetermined as in Expt-6. Expt-7 deleted, but this Expt. left in to show correction comment as I cannot add this at publication level. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Developmental cell 2008 imex curation Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu Accepted 2019-JUL-16 AT 07:53 BST AT 07:53 BST by ORCHARD Developmental cell 2008 Only protein-protein interactions imex curation imex curation I have amalgamated the 3 Expts - 1,6,7 a la Lukasz. I have added the Exp. Mod. from Expt 6, which should have had the figure legend as 2G - but did not. I have added with Participant Detection as Autoradiography, rather than Predetermined as in Expt-6. Expt-7 deleted, but this Expt. left in to show correction comment as I cannot add this at publication level. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Developmental cell 2008 imex curation Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu Accepted 2019-JUL-16 AT 07:53 BST AT 07:53 BST by ORCHARD Developmental cell 2008 Only protein-protein interactions imex curation imex curation I have amalgamated the 3 Expts - 1,6,7 a la Lukasz. I have added the Exp. Mod. from Expt 6, which should have had the figure legend as 2G - but did not. I have added with Participant Detection as Autoradiography, rather than Predetermined as in Expt-6. Expt-7 deleted, but this Expt. left in to show correction comment as I cannot add this at publication level. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Developmental cell 2008 imex curation Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Loktev AV., Zhang Q., Beck JS., Searby CC., Scheetz TE., Bazan JF., Slusarski DC., Sheffield VC., Jackson PK., Nachury MV. results from figure 7D have not been included as the species origin of the HDAC6 construct is not stated: -"from an in-house full-length cDNA collection". emailed authors 18/6/19 for fig 7D - gfp HDAC6 nachury@stanford.edu,pjackson@gene.com emails quoted above were returned;more recent email addresses might be:- Maxence.Nachury@ucsf.edu pjackson@stanford.edu Accepted 2019-JUL-16 AT 07:53 BST AT 07:53 BST by ORCHARD Developmental cell 2008 Only protein-protein interactions imex curation imex curation I have amalgamated the 3 Expts - 1,6,7 a la Lukasz. I have added the Exp. Mod. from Expt 6, which should have had the figure legend as 2G - but did not. I have added with Participant Detection as Autoradiography, rather than Predetermined as in Expt-6. Expt-7 deleted, but this Expt. left in to show correction comment as I cannot add this at publication level. bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE DIP protein Q3SYG4 original sequence version: 47 8E333B7680243B7A bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF ttc8_human Tetratricopeptide repeat protein 8 TTC8 BBS8 Bardet-Biedl syndrome 8 protein protein protein human Homo sapiens Human MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML DIP protein Q8TAM2 original sequence version: 114 DIP protein Q8TAM2 original sequence version: 85 013CFB0FDEBF385B bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS DIP protein Q8N3I7 original sequence version: 95 DIP protein Q8N3I7 original sequence version: 69 63D67D877FDFD25B bbip1_human BBSome-interacting protein 1 BBIP1 NCRNA00081 BBIP10 BBSome-interacting protein of 10 kDa protein protein human Homo sapiens Human MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH 25F2EE32DF0B948D pcm1_human Pericentriolar material 1 protein PCM1 protein protein human Homo sapiens Human MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDASTNPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTLRDQHLNNSSASPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESENEGHLNPSEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEVNSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPSLDCRYNREGEQEIHVAQGEDDEEEEEEAEEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTACPDLQLSAASVGNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRRKQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFSADENYRPLAKTRQQNISMQRQENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHFIMHQLNQCYTQLTWQQNNVQRLKQMLNELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQPVNLFNIPGFTNFSSFAPGMNFSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIGAEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLESFSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFERETHKISEQNDADNASVLSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNMRCTCRIIEDGDGAGAGTTVNNLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDKDKDETETVKQTQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQTSLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATSKNDQNNCPVKPCYLNILEDEQPLNSAAHKESPPTVDSTQQPNPLPLRLPEMEPLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI DIP protein Q15154 original sequence version: 101 DIP protein Q15154 original sequence version: 124 4625B991A443B6F3 bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF bbs4-bbip1-6 4 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1A bbs4-bbip1-8 3 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1C bbip1-bbs4-2 5 12 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 1D I cannot see any mention of the lap tag for this. bbip1-bbs4-3 2 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1E, Supplementary figure 9 BBS4 remained localized to centriolar satellites in BBIP10-depleted cells. bbs4-bbip1-10 1 13 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 weight silver stain molecular weight estimation by silver staining weight silver stain weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 1A, 2G/H, Supplementary figure 1 The subunit composition of the BBSome purified from cells without microtubules (+ nocodazole) was indistinguishable from the control. Alpha and beta tubulins were also detected, but the identity of the molecules found is not stated. When cells were depleted of BBIP10 by siRNA no BBSome subunits copurified with BBS4.