IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The majority of adrenocorticotropin receptor (melanocortin 2 receptor) mutations found in familial glucocorticoid deficiency type 1 lead to defective trafficking of the receptor to the cell surface. The majority of adrenocorticotropin receptor (melanocortin 2 receptor) mutations found in familial glucocorticoid deficiency type 1 lead to defective trafficking of the receptor to the cell surface. The Journal of clinical endocrinology and metabolism 2008 imex curation Chung TT., Webb TR., Chan LF., Cooray SN., Metherell LA., King PJ., Chapple JP., Clark AJ. Rare diseases - Interactions investigated in the context of Rare genetic disease a.j.clark@qmul.ac.uk 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chung TT., Webb TR., Chan LF., Cooray SN., Metherell LA., King PJ., Chapple JP., Clark AJ. Rare diseases - Interactions investigated in the context of Rare genetic disease a.j.clark@qmul.ac.uk Accepted 2019-NOV-13 AT 11:51 GMT AT 11:51 GMT by ORCHARD The Journal of clinical endocrinology and metabolism 2008 Only protein-protein interactions imex curation imex curation q8tcy5-1 Melanocortin-2 receptor accessory protein B27 Fat cell-specific low molecular weight protein Fat tissue-specific low MW protein Alpha MRAP-alpha MRAP C21orf61 FALP protein protein human Homo sapiens Human MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMRRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS 7F6A2A3D99045107 acthr_human Adrenocorticotropic hormone receptor MC2R ACTHR Adrenocorticotropin receptor Melanocortin receptor 2 protein protein human Homo sapiens Human MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW DIP protein Q01718 original sequence version: 81 DIP protein Q01718 original sequence version: 101 mc2r-mrap-4 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q01718:p.Leu55Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 20:20:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu55Pro' Q01718:p.Ile130Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 15:55:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile130Asn' Q01718:p.Arg137Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R W Tue Jun 30 20:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg137Trp' Q01718:p.Gly226Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 17:26:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly226Arg' n-n terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 4