IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural analysis of the complex of Keap1 with a prothymosin alpha peptide. Structural analysis of the complex of Keap1 with a prothymosin alpha peptide. Acta crystallographica. Section F, Structural biology and crystallization communications 2008 imex curation Padmanabhan B., Nakamura Y., Yokoyama S. paddy@gsc.riken.jp;yokoyama@biochem.s.u-tokyo.ac.jp 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Padmanabhan B., Nakamura Y., Yokoyama S. paddy@gsc.riken.jp;yokoyama@biochem.s.u-tokyo.ac.jp Accepted 2019-JUL-26 AT 14:41 BST AT 14:41 BST by PPORRAS Acta crystallographica. Section F, Structural biology and crystallization communications 2008 Only protein-protein interactions imex curation imex curation ptma_mouse Prothymosin alpha Ptma protein protein mouse Mus musculus Mouse MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD 345FACE953A3E8FA keap1_mouse Kelch-like ECH-associated protein 1 Cytosolic inhibitor of Nrf2 Keap1 Inrf2 Kiaa0132 protein protein mouse Mus musculus Mouse MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHTKQAFGVMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLATLISRDDLNVRCESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQLQKCEILQADARCKDYLVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC DIP protein Q9Z2X8 original sequence version: 104 4645DB0122FB5F54 keap1-ptma-1 1 2 unspecified role unspecified role neutral component neutral component purified purified ProTalpha sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified DC DGR and CTR domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 8 direct interaction direct interaction Fig.1, Fig.2 Rwork = 0.166 Rfree = 0.223 1.9 Å