IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The Journal of biological chemistry 2007 imex curation Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis predetermined predetermined participant predetermined Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). the pcDNA3 dna sequence from both Addgene and Invitrogen gives a >99.? match to construct entered - LC311018.1 "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se Accepted 2020-JAN-13 AT 13:28 GMT AT 13:28 GMT by KALPANAP The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The Journal of biological chemistry 2007 imex curation Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se Accepted 2020-JAN-13 AT 13:28 GMT AT 13:28 GMT by KALPANAP The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The Journal of biological chemistry 2007 imex curation Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se Accepted 2020-JAN-13 AT 13:28 GMT AT 13:28 GMT by KALPANAP The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The factor H variant associated with age-related macular degeneration (His-384) and the non-disease-associated form bind differentially to C-reactive protein, fibromodulin, DNA, and necrotic cells. The Journal of biological chemistry 2007 imex curation Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Sjöberg AP., Trouw LA., Clark SJ., Sjölander J., Heinegård D., Sim RB., Day AJ., Blom AM. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). "CCP 6-8" deteremined to correspond to Sushi domains 6-8 by Blat of primers (Ref 5). The Factor H mutation Tyr384His in this publication has been found to equivalent to Tyr402His in the current sequence version of Factor H in UniProt. (see PMID: 2963625, from Ref. 5 in this publication). anna.blom@med.lu.se Accepted 2020-JAN-13 AT 13:28 GMT AT 13:28 GMT by KALPANAP The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE fmod_bovin Fibromodulin FMOD Collagen-binding 59 kDa protein Keratan sulfate proteoglycan fibromodulin protein protein bovin Bos taurus (Bovine) Bovine MQWASILLLAGLCSLSWAQYEEDSHWWFQFLRNQQSTYDDPYDPYPYEPYEPYPYGGEEGPAYAYGSPPQPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQISSIQEGVFDNATGLLWIALHGNQITSDKVGKKVFSKLRHLERLYLDHNNLTRIPSPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLHHNEIQEVGSSMKGLRSLILLDLSYNHLRKVPDGLPSALEQLYLEHNNVFSVPDSYFRGSPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVSTNLENLYLQGNRINEFSISSFCTVVDVMNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI CC4AA5B0AC79907B flag-mcs-pcdna3.1 flag-mcs-pcdna3.1 dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid synthetic construct synthetic construct GACGGATCGGGAGATCTCCCGATCCCCTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCTGGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAATACGACTCACTATAGGGAGACCCAAGCCGCCATGGACTACAAGGACGACGATGACAAGGGATCCGCTAGCGAATTCGATATCAAGCTTGGTACCGCGGCCGCTCGAGCATGCATCTAGAGGGCCCTATTCTATAGTGTCACCTAAATGCTAGAGCTCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTAACGCGAATTAATTCTGTGGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCTGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAAAGCTCCCGGGAGCTTGTATATCCATTTTCGGATCTGATCAAGAGACAGGATGAGGATCGTTTCGCATGATTGAACAAGATGGATTGCACGCAGGTTCTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAACAGACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCGCCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAACTGCAGGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGCTGTGCTCGACGTTGTCACTGAAGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCTGCCGAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTGCATACGCTTGATCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAGCACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGACGAAGAGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGCGCATGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATGCCTGCTTGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGCCGGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTGATATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTACGGTATCGCCGCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTTCTTGACGAGTTCTTCTGAGCGGGACTCTGGGGTTCGAAATGACCGACCAAGCGACGCCCAACCTGCCATCACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC phosphocholine phosphocholine Choline phosphate ChoP N-Trimethyl-2-aminoethylphosphonate O-Phosphocholine O-phosphocholine PHOSPHOCHOLINE Phosphocholine Phosphoryl-choline Phosphorylcholine Trimethyl(2-(phosphonooxy)ethyl)ammonium N,N,N-trimethyl-2-(phosphonooxy)ethanaminium small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 crp-cfh-13 2 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 9 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A, 3A Full-length FH does not compete with C1q for the binding. crp-cfh-14 2 9 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 16:36:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A crp-cfh-15 3 9 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:35:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 crp-cfh-16 4 9 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:17:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 His-384 binds CRP with a K D of 19 u M , and the corresponding value for Tyr-384 is 12 uM. crp-cfh-17 2 8 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 3B I assume Full length FH here fmod-cfh-1 2 6 unspecified role unspecified role bait bait purified purified bovin-cartilage Bos taurus cartilage Cartilage 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 4A/C Deglycosylated FMOD bound FH significantly better than the glycosylated (e.g. keratan sulfate) containing form. crp-cfh-18 2 6 unspecified role unspecified role bait bait purified purified bovin-cartilage Bos taurus cartilage Cartilage 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:33:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A-2 crp-cfh-19 3 6 unspecified role unspecified role bait bait purified purified bovin-cartilage Bos taurus cartilage Cartilage 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 15:58:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B fmod-cfh-2 4 6 unspecified role unspecified role bait bait purified purified bovin-cartilage Bos taurus cartilage Cartilage 5 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:33:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 crp-cfh-20 1 5 unspecified role unspecified role neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role neutral component neutral component purified purified synthetic construct synthetic construct direct interaction direct interaction 6 Full-length FH does not compete with C1q for the binding. crp-cfh-21 1 5 unspecified role unspecified role neutral component neutral component purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08603:p.Tyr402His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:50:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified synthetic construct synthetic construct direct interaction direct interaction 6 The His-384 construct interacts more tightly with DNA than the Tyr-384 form, which exhibits only weak binding.