UniProt UniProt http://www.uniprot.org CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov Accepted 2019-DEC-05 AT 12:54 GMT AT 12:54 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2005 Only protein-protein interactions imex curation imex curation CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov Accepted 2019-DEC-05 AT 12:54 GMT AT 12:54 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2005 Only protein-protein interactions imex curation imex curation CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 chromatography chromatography technology column chromatography chromatography western blot western blot Immuno blot Immuno blot Zhou S., Zhou H., Walian PJ., Jap BK. Cell membranes were detergent solubilized, centrifuged and applied to a Q-Sepharose HP column. Bound proteins were eluted with a NaCl step gradient, fractions were evaluated by Western blot with antibodies against Nct and Psn-1 CTF. These fractions were pooled and loaded onto a lentil lectin column, bound proteins eluted at 200 mM methyl α-d-mannopyranoside. The eluted fractions were pooled, concentrated, and applied to a Superdex 200 molecular sieve column. APH1 was also identified but could not be mapped to a single gene product bkjap@lbl.gov Accepted 2019-DEC-05 AT 12:54 GMT AT 12:54 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2005 Only protein-protein interactions imex curation imex curation CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hcn1a human hcn1a hcn1a HCN-1A neuronal cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov Accepted 2019-DEC-05 AT 12:54 GMT AT 12:54 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2005 Only protein-protein interactions imex curation imex curation CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou S., Zhou H., Walian PJ., Jap BK. bkjap@lbl.gov Accepted 2019-DEC-05 AT 12:54 GMT AT 12:54 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2005 Only protein-protein interactions imex curation imex curation pen2_human Gamma-secretase subunit PEN-2 Presenilin enhancer protein 2 PSENEN PEN2 MDS033 protein protein human Homo sapiens Human MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP DIP protein Q9NZ42 original sequence version: 125 FDBA4D299488EA02 p49768-pro_0000025591 Presenilin-1 NTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 58C420367AAEC20B basi_human Basigin Leukocyte activation antigen M6 Collagenase stimulatory factor Extracellular matrix metalloproteinase inducer 5F7 Tumor cell-derived collagenase stimulatory factor OK blood group antigen BSG UNQ6505/PRO21383 Hepatoma-associated antigen protein protein human Homo sapiens Human MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS D74C37455BF26685 p49768-pro_0000025592 Presenilin-1 CTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human AEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI 299 467 3E9D952750443B00 nica_human Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 protein protein human Homo sapiens Human MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY DIP protein Q92542 original sequence version: 74 DIP protein Q92542 original sequence version: 146 C8C0EAEAD89E976A bsg-ncstn-1 3 9 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 sequence tag sequence tag identification sequence tag western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1, 2 bsg-ncstn-2 1 10 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig. 3A bsg-psen1-2 1 9 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig. 3A psen1-bsg-1 1 9 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig. 3B psen1-ncstn-4 1 9 unspecified role unspecified role bait bait purified purified 10 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig. 3B ncstn-psen1-1 1 9 unspecified role unspecified role prey prey purified purified 10 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig. 3C ncstn-bsg-1 1 10 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig. 3C bsg-psen1-1 4 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supp Fig. 6A bsg-ncstn-3 5 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supp Fig. 6B bsg-ncstn-4 2 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supp Fig. 6C