IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Atopic dermatitis is associated with a functional mutation in the promoter of the C-C chemokine RANTES. Atopic dermatitis is associated with a functional mutation in the promoter of the C-C chemokine RANTES. Journal of immunology (Baltimore, Md. : 1950) 2000 imex curation Nickel RG., Casolaro V., Wahn U., Beyer K., Barnes KC., Plunkett BS., Freidhoff LR., Sengler C., Plitt JR., Schleimer RP., Caraballo L., Naidu RP., Levett PN., Beaty TH., Huang SK. The G allele corresponds in ensembl to the wt promoter. Also the probe is the reverse sequence, as such the mutation has been remapped to the main strand. skhuang@mail.jhmi.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Nickel RG., Casolaro V., Wahn U., Beyer K., Barnes KC., Plunkett BS., Freidhoff LR., Sengler C., Plitt JR., Schleimer RP., Caraballo L., Naidu RP., Levett PN., Beaty TH., Huang SK. The G allele corresponds in ensembl to the wt promoter. Also the probe is the reverse sequence, as such the mutation has been remapped to the main strand. skhuang@mail.jhmi.edu Accepted 2020-JAN-31 AT 08:09 GMT AT 08:09 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2000 Only protein-protein interactions imex curation imex curation gata2_human Endothelial transcription factor GATA-2 GATA-binding protein 2 GATA2 protein protein human Homo sapiens Human MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG DIP protein P23769 original sequence version: 74 DIP protein P23769 original sequence version: 71 C879CC932C355E6A ccl5_human_gene C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES gene gene human Homo sapiens Human gata1_human Erythroid transcription factor GATA1 ERYF1 GF1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein human Homo sapiens Human MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS DIP protein P15976 original sequence version: 163 DIP protein P15976 original sequence version: 113 DIP protein P15976 original sequence version: 146 822BD2DE14B908AD gata3_human Trans-acting T-cell-specific transcription factor GATA-3 GATA3 GATA-binding factor 3 protein protein human Homo sapiens Human MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG DIP protein P23771 original sequence version: 160 F24C58681E1D02A5 gata1-rantes-1 1 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hmc-1-8 Human HMC-1-8 - Breast Carcinoma cell line hmc-1-8 HMC-1-8 - Breast Carcinoma cell line 3 unspecified role unspecified role bait bait purified purified radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880766-35880784 GAAAGGAGATAAGATCTG NC_000017.11:g.35880776C>T mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880776-35880776 chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3 ccl5-gata1-1 1 2 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hmc-1-8 Human HMC-1-8 - Breast Carcinoma cell line hmc-1-8 HMC-1-8 - Breast Carcinoma cell line 3 unspecified role unspecified role bait bait purified purified radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880766-35880784 GAAAGGAGATAAGATCTG NC_000017.11:g.35880776C>T mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880776-35880776 chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3 ccl5-gata2-1 1 5 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-jurkat Homo sapiens jurkat Human T cell leukemia 3 unspecified role unspecified role bait bait purified purified radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880766-35880784 (-) GAAAGGAGATAAGATCTG NC_000017.11:g.35880776C>T mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17:35880776-35880776 chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4