DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The atomic-resolution structure of human caspase-8, a key activator of apoptosis. The atomic-resolution structure of human caspase-8, a key activator of apoptosis. Structure (London, England : 1993) 1999 imex curation Watt W., Koeplinger KA., Mildner AM., Heinrikson RL., Tomasselli AG., Watenpaugh KD. keith.d.watenpaugh@am.pnu.com 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watt W., Koeplinger KA., Mildner AM., Heinrikson RL., Tomasselli AG., Watenpaugh KD. keith.d.watenpaugh@am.pnu.com Accepted 2019-MAR-06 AT 12:06 GMT AT 12:06 GMT by ORCHARD Structure (London, England : 1993) 1999 imex curation q14790-pro_0000004631 Caspase-8 subunit p10 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog protein protein human Homo sapiens Human LSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD 385 479 8CFAF0089502601D q14790-pro_0000004629 Caspase-8 subunit p18 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog protein protein human Homo sapiens Human SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD 217 374 B7C51C40CE9EF10E casp8-casp8-2 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2, Table 2, 3