UniProt UniProt http://www.uniprot.org Molecular characterization of Escherichia coli FtsE and FtsX. Molecular characterization of Escherichia coli FtsE and FtsX. Molecular microbiology 1999 imex curation de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. luirink@bio.vu.nl 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. luirink@bio.vu.nl Accepted 2020-MAR-03 AT 11:00 GMT AT 11:00 GMT by MGT Molecular microbiology 1999 Only protein-protein interactions imex curation imex curation Molecular characterization of Escherichia coli FtsE and FtsX. Molecular characterization of Escherichia coli FtsE and FtsX. Molecular microbiology 1999 imex curation de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. luirink@bio.vu.nl 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) comigration in sds comigration in sds page comigration in sds partial id prot seq partial identification of protein sequence partial id prot seq de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. luirink@bio.vu.nl Accepted 2020-MAR-03 AT 11:00 GMT AT 11:00 GMT by MGT Molecular microbiology 1999 Only protein-protein interactions imex curation imex curation Molecular characterization of Escherichia coli FtsE and FtsX. Molecular characterization of Escherichia coli FtsE and FtsX. Molecular microbiology 1999 imex curation de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. luirink@bio.vu.nl 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J. ftsE labelled with the photoreactive ATP analogue 8-azido[a-32P]-ATP using UV light. luirink@bio.vu.nl Accepted 2020-MAR-03 AT 11:00 GMT AT 11:00 GMT by MGT Molecular microbiology 1999 Only protein-protein interactions imex curation imex curation ftsx_ecoli Cell division protein FtsX ftsX ftsS b3462 JW3427 protein protein ecoli Escherichia coli (strain K12) MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE DIP protein P0AC30 original sequence version: 60 C006ED56043739AE atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 adp adenosine 5'-(trihydrogen diphosphate) (ADP) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ftse_ecoli Cell division ATP-binding protein FtsE ftsE b3463 JW3428 protein protein ecoli Escherichia coli (strain K12) MIRFEHVSKAYLGGRQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDINLISRRSYRMLTLSDGHLHGGVGHE 13CFCDECD8FE7590 13CFCDECD8FE7590 ftse-1 2 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0A9R7:p.Lys41Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 15:46:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys41Arg' P0A9R7:p.Cys49Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 18:36:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys49Ala' direct interaction direct interaction Fig. 1A, 2 ftsx-ftse-1 1 4 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Fig. 7 atp-ftse-1 3 5 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8-azido tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0A9R7:p.Lys41Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 16:19:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys41Arg' P0A9R7:p.Cys49Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:50:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys49Ala' direct interaction direct interaction Fig. 5 atp-atp-1 3 5 competitor competitor competitor neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8-azido tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0A9R7:p.Lys41Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 16:18:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys41Arg' P0A9R7:p.Cys49Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 15:53:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys49Ala' direct interaction direct interaction Fig. 5 adp-atp-1 3 7 competitor competitor competitor neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8-azido tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0A9R7:p.Lys41Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 17:39:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys41Arg' P0A9R7:p.Cys49Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 15:45:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys49Ala' direct interaction direct interaction Fig. 5 atp-ftse-2 3 6 competitor competitor competitor neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8-azido tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0A9R7:p.Lys41Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 16:59:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys41Arg' P0A9R7:p.Cys49Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 20:11:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys49Ala' direct interaction direct interaction Fig. 5