MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. Cell death & disease 2018 imex curation Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L., Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; Accepted 2019-MAR-07 AT 13:48 GMT AT 13:48 GMT by LUANA Cell death & disease 2018 imex curation UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. Cell death & disease 2018 imex curation Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L., Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; Accepted 2019-MAR-07 AT 13:48 GMT AT 13:48 GMT by LUANA Cell death & disease 2018 imex curation UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. Cell death & disease 2018 imex curation Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L., Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; Accepted 2019-MAR-07 AT 13:48 GMT AT 13:48 GMT by LUANA Cell death & disease 2018 imex curation UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. UBIAD1 suppresses the proliferation of bladder carcinoma cells by regulating H-Ras intracellular trafficking via interaction with the C-terminal domain of H-Ras. Cell death & disease 2018 imex curation Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L., Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Xu Z., Duan F., Lu H., Abdulkadhim Dragh M., Xia Y., Liang H., Hong L. lhong@mail.hust.edu.cn <lhong@mail.hust.edu.cn>; Accepted 2019-MAR-07 AT 13:48 GMT AT 13:48 GMT by LUANA Cell death & disease 2018 imex curation rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein P01112 original sequence version: 91 DIP protein P01112 original sequence version: 106 DIP protein P01112 original sequence version: 144 DIP protein P01112 original sequence version: 118 DIP protein P01112 original sequence version: 143 DIP protein P01112 original sequence version: 152 DIP protein P01112-1 original sequence version: 159 DIP protein P01112 original sequence version: 170 DIP protein P01112-1 original sequence version: 185 DIP protein P01112 original sequence version: 192 DIP protein P01112-1 original sequence version: 196 DIP protein P01112-1 original sequence version: 202 EE6DC2D933E2856A ubia1_human UbiA prenyltransferase domain-containing protein 1 UBIAD1 TERE1 Transitional epithelial response protein 1 protein protein human Homo sapiens Human MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI 02808542DB9EA249 hras-ubiad1-1 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y5Z9:p.Asn102Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N S Tue Jun 30 16:05:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn102Ser' Q9Y5Z9:p.Arg54_Ser57delinsAlaAlaAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain RPWS AAAA Tue Jun 30 20:18:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg54_Ser57delinsAlaAlaAlaAla' colocalization colocalization fig.2a; suppl fig 2b, fig.7a The results showed that UBIAD1 increased the retention of H-Ras in the Golgi apparatus after treatment with cycloheximide, which blocks protein synthesis (Fig. 2a). Same colocalization was detected in T24 cell. hras-ubiad1-2 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell bfp tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization fig.4a When UBIAD1 and H-Ras were overexpressed in HEK293T cells, both molecules colocalized in the Golgi apparatus (Fig. 4a). hras-ubiad1-3 1 5 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell bfp tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction fig.4b, suppl. fig.3b To provide evidence that UBIAD1 forms a complex with H-Ras, a fluorescence resonance energy transfer (FRET) assay was employed to detect this molecular interaction. Significant FRET signals were detected with 405-515 microscope channels when HEK293T cells were cotransfected with UBIAD1 and H-Ras (Fig. 4b). hras-ubiad1-4 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association fig. 4c, fig. 3d immunoprecipitation of UBIAD1 could pull-down H-Ras (Fig. 4c), and vice versa (Supplementary Fig. S3d, e). 2-bromopalmitate ubiad1-hras-1 3 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01112:p.Gly12Val mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G V Tue Jun 30 19:14:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' 6 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association suppl fig. 3d immunoprecipitation of UBIAD1 could pull-down H-Ras (Fig. 4c), and vice versa (Supplementary Fig. S3d, e). hras-ubiad1-5 3 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region deletion analysis deletion analysis inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association fig. 5d To determine the binding region of H-Ras for UBIAD1, a truncated H-Ras protein was fused with GFP. As shown in Fig. 5d and Supplementary Fig. S4d, the C-terminus of H-Ras interacted with UBIAD1. hras-ubiad1-6 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region deletion analysis deletion analysis inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association fig. 5e, fig.5c, suppl. fig.4d immunoprecipitation of UBIAD1 could pull-down H-Ras (Fig. 4c), and vice versa (Supplementary Fig. S3d, e). To determine the binding region of H-Ras for UBIAD1, a truncated H-Ras protein was fused with GFP. As shown in Fig. 5d and Supplementary Fig. S4d, the C-terminus of H-Ras interacted with UBIAD1. hras-ubiad1-7 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell bfp tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization suppl. fig.6c statins were also able to disrupt the function of Ras because FPP is necessary for the post-translational modification of Ras (Supplementary Fig. S6c). Therefore, statins can block the function of both UBIAD1 and Ras, consistent with those of previous studies statins hras-ubiad1-8 4 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association suppl. fig.3c BIFC signals were detected only in HEK293T cells cotransfected with UBIAD1 and H-Ras (Supplementary Fig. S3c).