DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Nature 2018 imex curation Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au Accepted 2018-NOV-22 AT 08:19 GMT AT 08:19 GMT by ORCHARD Nature 2018 imex curation Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Nature 2018 imex curation Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au Accepted 2018-NOV-22 AT 08:19 GMT AT 08:19 GMT by ORCHARD Nature 2018 imex curation Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Nature 2018 imex curation Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au Accepted 2018-NOV-22 AT 08:19 GMT AT 08:19 GMT by ORCHARD Nature 2018 imex curation Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Nature 2018 imex curation Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au Accepted 2018-NOV-22 AT 08:19 GMT AT 08:19 GMT by ORCHARD Nature 2018 imex curation Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Structure of the membrane-assembled retromer coat determined by cryo-electron tomography. Nature 2018 imex curation Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) sls static light scattering sls weight by comassie molecular weight estimation by coomasie staining weight by comassie Kovtun O., Leneva N., Bykov YS., Ariotti N., Teasdale RD., Schaffer M., Engel BD., Owen DJ., Briggs JAG., Collins BM. b.collins@imb.uq.edu.au Accepted 2018-NOV-22 AT 08:19 GMT AT 08:19 GMT by ORCHARD Nature 2018 imex curation g0s0e6_chatd CTHT_0009750 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSYFFSTPVDIDIVLADADKRAMVDVKLDKNRREKVPLYMDGESVKGCVTVRPKDGKRLEHTGIKVQFIGTIEMFFDRGNHYEFLSLVQELAAPGELQHPQTFDFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVIREKDIWVYSYRIPPELNSSIKMDVGIEDCLHIEFEYSKSKYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGVAPNQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKFSTRYYLSLVLIDEDARRYFKQSEIILYRQPPEYDNQLLPPPPDQKQVTAPLA 8B36187C94E71748 g0rzb5_chatd Vacuolar protein sorting-associated protein 29 CTHT_0002370 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAFLILVIGNLHIPDRALDIPPKFKKLLSPGKISQTLCLGNLTDRATYDYLRSISPDLKIVRGRMDVEATSLPLMQVVTHGSLRIGFLEGFTLVSEEPDVLLAEANKLDVDVLCWAGGSHRFECFEYMDKFFVNPGSATGAFTTDWLAEGEEVVPSFCLMDVQGISLTLYVYQLRKDENGTENVAVEKVTYTKPVEPTGAS DB594BF34AF1F96A g0sh11_chatd CTHT_0068290 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MEDPWADTASPNSSAPLSQHVEDSSSAPAAAAETPSNTATTTAPSISTSSRPSRATPRRIVAKPKSLEAVEDDPLGPLGAPTPSSDSDNNGLGGATARGVQPPVPPLKEQLPLRTTLPPSTTNRGGRGRRSGPPDPHHIDDDDDDAALFGSAGRGRPPPPVPASLPSPVKSSTAPSMSVEQAARPTFHITVGDPHKVGDLATSHIVYSVRTKTTSKAYKQPEFEVKRRYRDFLWLYNTLHSNNPGVVVPPPPEKQAVGRFESNFVESRRAALEKMLNKIAAHPTLQLDADLKLFLESESFNIDVKHKERKEPPLGESKGVFGSLGFGGGGNKFVEQDDWFHDRRVYLDALENQLKALLKAMDNMVAQRKAMAEAAADFSASLHALSTVELSPTLSGPLDALSELQLAIRDVYERQAQQDVLTFGIIIEEYIRLIGSVKQAFSQRQKAFHSWHSAESELMKKKAAQDKLLRQGKTQQDRLNQVNAEVIDAERKVHQARLLFEDMGRLLRSELDRFEREKVEDFKSGVETFLESAVEAQKELIEKWETFLMQLDAEDDESVFYRPPPVQTKKPAGDTAVDRARARIDEDSD B3FA24CA6FD491E0 g0s709_chatd Vacuolar protein sorting-associated protein 35 CTHT_0035730 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSTPAPPEEQARLLEDALIAVRQQTAMMRKFLDTPGKLMDALKCCSTLVSELRTSSLSPKQYYELYMAVFDALRYLSAHLRENHPVNHLADLYELVQYAGNIIPRLYLMITVGTAYMSIDGAPVKELMKDMMDMSRGVQHPVRGLFLRYYLSGQARDYLPTGDSDGPEGNLQDSINFILTNFVEMNKLWVRLQHQGHSRERDLRTQERRELQLLVGSNIVRLSQLVDLPTYRDSILGPLLEQIVQCRDILAQEYLLEVITQVFPDEYHLHTLDQFLGAVSRLNPHVNVKAIVIGMMNRLSDYAERESQNEPEEDRAKLEEEALAKLLEKTKLGQNSELEPQNGDHPDTEVSSTTDSAQAPSTADSDTTAVNGEEEPVRKRRGIPVNVPLYDIFFDQVQHLVQAQHLPIQDTIALCCSLANLSLNIYPERLDYVDGILAYALAKVKEHANSADLHSQPAQQSLLSLLQSPLRRYVSIFTALSLPTYVSLFQAQTYPTRRAIAGEIVRTLLKNQTLISTPAHLENVLEILKVLIKEGSQPPAGYPGVVQPRARPLETDETMEEQGWLARLVHLIHSDDNDTQFRLLQMTRKAYAEGNERIRTTTPPLITAGLKLARRFKAREHYDDNWSSQSSSLFKFLHSAISTLYTRVNGPGVADLCLRLFCSCGQVADMTEFEEVAYEFFAQAFTVYEESISDSKAQFQAVCVIASALHRTRNFGRENYDTLITKCAQHASKLLRKPDQCRAVYLASHLWWATPIAARGETEDTELYRDGKRVLECLQRALRVADSCMETATSIELFVEILDRYVYYFDQRNESVTTKYLNGLIELIHSNLAGNQQDSASVEASRKHFIQTLEMIQSKEFEGIVVAPK DF8F1F3336343530 g0rzb5_chatd-g0s0e6_chatd-1 1 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig 1a, Extended Data Fig 1a-d, Extended Data Table 1 g0sh11_chatd-1 5 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Extended Data Fig 1c g0rzb5_chatd-1 2 7 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Extended Data Fig 1d g0rzb5_chatd-g0s0e6_chatd-2 3 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig 1a g0sh11_chatd-2 4 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Extended Data Fig 1b