DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Nature 2018 imex curation Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be Accepted 2018-NOV-06 AT 10:12 GMT AT 10:12 GMT by ORCHARD Nature 2018 imex curation Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Nature 2018 imex curation Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be Accepted 2018-NOV-06 AT 10:12 GMT AT 10:12 GMT by ORCHARD Nature 2018 imex curation Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Nature 2018 imex curation Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eelen G., Dubois C., Cantelmo AR., Goveia J., Brüning U., DeRan M., Jarugumilli G., van Rijssel J., Saladino G., Comitani F., Zecchin A., Rocha S., Chen R., Huang H., Vandekeere S., Kalucka J., Lange C., Morales-Rodriguez F., Cruys B., Treps L., Ramer L., Vinckier S., Brepoels K., Wyns S., Souffreau J., Schoonjans L., Lamers WH., Wu Y., Haustraete J., Hofkens J., Liekens S., Cubbon R., Ghesquière B., Dewerchin M., Gervasio FL., Li X., van Buul JD., Wu X., Carmeliet P. peter.carmeliet@kuleuven.vib.be Accepted 2018-NOV-06 AT 10:12 GMT AT 10:12 GMT by ORCHARD Nature 2018 imex curation rhoj_human Rho-related GTP-binding protein RhoJ RHOJ ARHJ RASL7B RHOI TCL Ras-like protein family member 7B Tc10-like GTP-binding protein protein protein human Homo sapiens Human MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII AAD2E2CED036F48C glna_human Glutamine synthetase Glutamate--ammonia ligase GLUL GLNS Palmitoyltransferase GLUL protein protein human Homo sapiens Human MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN DIP protein P15104 original sequence version: 163 45390C100924FAF3 q9h4e5-1 Rho-related GTP-binding protein RhoJ Ras-like protein family member 7B Tc10-like GTP-binding protein RHOJ ARHJ RASL7B RHOI TCL protein protein human Homo sapiens Human MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII AAD2E2CED036F48C glul-rhoj-1 3 5 unspecified role unspecified role bait bait native native 4 unspecified role unspecified role prey prey native native physical association physical association Fig 5a rhoj-glul-1 3 5 unspecified role unspecified role prey prey native native 4 unspecified role unspecified role bait bait native native physical association physical association Fig 5a glul-rhoj-2 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed eGFP tag eGFP tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range p.Asn2_Lys20del deltaN20 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain NCKEGTDSSCGCRGNDEKK . physical association physical association Extended Data Fig 7b glul-rhoj-3 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nGFP tag N-term eGFP tag ngfp nGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cGFP tag C-term eGFP tag cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range p.Asn2_Lys20del deltaN20 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain NCKEGTDSSCGCRGNDEKK . physical association physical association Extended Data Fig 7d, e