DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryo-EM structure of a fungal mitochondrial calcium uniporter. Cryo-EM structure of a fungal mitochondrial calcium uniporter. Nature 2018 imex curation Nguyen NX., Armache JP., Lee C., Yang Y., Zeng W., Mootha VK., Cheng Y., Bai XC., Jiang Y. youxing.jiang@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Nguyen NX., Armache JP., Lee C., Yang Y., Zeng W., Mootha VK., Cheng Y., Bai XC., Jiang Y. youxing.jiang@utsouthwestern.edu Accepted 2018-SEP-04 AT 08:42 BST AT 08:42 BST by ORCHARD Nature 2018 imex curation a1cwt6_neofi Calcium uniporter protein NFIA_105760 protein protein Aspergillus fischerianus Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) MRALVSRTPIAAALRSATLGSQCASIQYNSLNILDRLPQPLPSRSFRIRYTGVSTSGRVTQTCRRSFQLSASSRDKRGPQSAEPDPLERLEVKKVQQQHENEKDDSGRDTKSGGKVAKAMTKGDTIAGKLLTTPSRLFKLLIPLTTINRKDIEQIAILIHPQQPLSHLERLIQSEVPPIEDENGQKRPPAVSFIALQLEQDAIRPKRGMYEGTDAEIHRVEGGKDDATVAKRGEDFQEVDETFSYLRRPGPGQGDKEQRFIRWSQSTEIGDFIRDAARAKEFIVTIEGAPAGLEQIHVAVPSFDERTYFLRMRLRKISRRIQGLAEIKHECDALAHRGAQRVALGGFGILAFWWYIVYKLTFETDLGWDTMEPVTYLVSLSTLMGGYLWFLYHNREISYRSALDFTINARQKKLYQMKGIDLQVWESLIDEANAIRREIKNIAAEYDVDWDERKDEQDDRVTEALKKERRLKNGSQKEERPKDDRDDD DB4CACF3831D7C0D a1cwt6_neofi-1 1 2 unspecified role unspecified role unspecified role unspecified role purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig 1, Extended Data Table 1