DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural principles of distinct assemblies of the human α4β2 nicotinic receptor. Structural principles of distinct assemblies of the human α4β2 nicotinic receptor. Nature 2018 imex curation Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE., Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE. ryan.hibbs@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293s Human 293S cell line Human 293s 293S cell line 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE., Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE. ryan.hibbs@utsouthwestern.edu Accepted 2018-AUG-30 AT 10:52 BST AT 10:52 BST by ORCHARD Nature 2018 imex curation Structural principles of distinct assemblies of the human α4β2 nicotinic receptor. Structural principles of distinct assemblies of the human α4β2 nicotinic receptor. Nature 2018 imex curation Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE., Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE. ryan.hibbs@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293s Human 293S cell line Human 293s 293S cell line molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE., Walsh RM., Roh SH., Gharpure A., Morales-Perez CL., Teng J., Hibbs RE. ryan.hibbs@utsouthwestern.edu Accepted 2018-AUG-30 AT 10:52 BST AT 10:52 BST by ORCHARD Nature 2018 imex curation achb2_human Neuronal acetylcholine receptor subunit beta-2 CHRNB2 protein protein human Homo sapiens Human MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPSSK 7EEDEF6ADFDC9F23 p43681-1 Neuronal acetylcholine receptor subunit alpha-4 CHRNA4 NACRA4 protein protein human Homo sapiens Human MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI B3A0C0151E5A2AA8 chrna4-chrnb2-3 1 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P43681-1:p.Phe585_Ser586insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain FS FERS Tue Jun 30 19:25:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe585_Ser586insGluArg' human Homo sapiens Human 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P17787:p.Gln445_Ser446insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain QS QERS Tue Jun 30 16:30:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln445_Ser446insGluArg' strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association Figure 1 chrna4-chrnb2-4 1 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain p.Phe585_Ser586insGluArg Glu-Arg Linker cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain FS FERS human Homo sapiens Human 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P17787:p.Gln445_Ser446insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain QS QERS Tue Jun 30 16:45:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln445_Ser446insGluArg' strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association Figure 1 chrna4-chrnb2-5 2 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P43681-1:p.Phe585_Ser586insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain FS FERS Tue Jun 30 18:41:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe585_Ser586insGluArg' human Homo sapiens Human 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P17787:p.Gln445_Ser446insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain QS QERS Tue Jun 30 15:47:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln445_Ser446insGluArg' strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association Figure 1 chrna4-chrnb2-6 2 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P43681-1:p.Phe585_Ser586insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain FS FERS Tue Jun 30 19:04:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe585_Ser586insGluArg' human Homo sapiens Human 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P17787:p.Gln445_Ser446insGluArg Glu-Arg Insertion mutation mutation certain certain sequence position certain certain certain sequence position certain QS QERS Tue Jun 30 18:46:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln445_Ser446insGluArg' strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association Figure 1