DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the human myostatin precursor and determinants of growth factor latency. Structure of the human myostatin precursor and determinants of growth factor latency. The EMBO journal 2018 imex curation Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk Accepted 2018-NOV-01 AT 13:33 GMT AT 13:33 GMT by ORCHARD The EMBO journal 2018 imex curation LS> all we know is that there's no change after cutting so the two parts got to stick together; i'm not sure if the sax profile is enough to claim we've got a dimer of uncut protein. LS> There's no interaction in 2C - all myostatin molecules are his-tagged, fst288 does nothing. in 2D fst288 does interact with pro-activin but there's not enough info on pro-activin to annotate it :o/ Structure of the human myostatin precursor and determinants of growth factor latency. Structure of the human myostatin precursor and determinants of growth factor latency. The EMBO journal 2018 imex curation Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk Accepted 2018-NOV-01 AT 13:33 GMT AT 13:33 GMT by ORCHARD The EMBO journal 2018 imex curation LS> all we know is that there's no change after cutting so the two parts got to stick together; i'm not sure if the sax profile is enough to claim we've got a dimer of uncut protein. LS> There's no interaction in 2C - all myostatin molecules are his-tagged, fst288 does nothing. in 2D fst288 does interact with pro-activin but there's not enough info on pro-activin to annotate it :o/ Structure of the human myostatin precursor and determinants of growth factor latency. Structure of the human myostatin precursor and determinants of growth factor latency. The EMBO journal 2018 imex curation Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk Accepted 2018-NOV-01 AT 13:33 GMT AT 13:33 GMT by ORCHARD The EMBO journal 2018 imex curation LS> all we know is that there's no change after cutting so the two parts got to stick together; i'm not sure if the sax profile is enough to claim we've got a dimer of uncut protein. LS> There's no interaction in 2C - all myostatin molecules are his-tagged, fst288 does nothing. in 2D fst288 does interact with pro-activin but there's not enough info on pro-activin to annotate it :o/ Structure of the human myostatin precursor and determinants of growth factor latency. Structure of the human myostatin precursor and determinants of growth factor latency. The EMBO journal 2018 imex curation Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk Accepted 2018-NOV-01 AT 13:33 GMT AT 13:33 GMT by ORCHARD The EMBO journal 2018 imex curation LS> all we know is that there's no change after cutting so the two parts got to stick together; i'm not sure if the sax profile is enough to claim we've got a dimer of uncut protein. LS> There's no interaction in 2C - all myostatin molecules are his-tagged, fst288 does nothing. in 2D fst288 does interact with pro-activin but there's not enough info on pro-activin to annotate it :o/ Structure of the human myostatin precursor and determinants of growth factor latency. Structure of the human myostatin precursor and determinants of growth factor latency. The EMBO journal 2018 imex curation Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk Accepted 2018-NOV-01 AT 13:33 GMT AT 13:33 GMT by ORCHARD The EMBO journal 2018 imex curation LS> all we know is that there's no change after cutting so the two parts got to stick together; i'm not sure if the sax profile is enough to claim we've got a dimer of uncut protein. LS> There's no interaction in 2C - all myostatin molecules are his-tagged, fst288 does nothing. in 2D fst288 does interact with pro-activin but there's not enough info on pro-activin to annotate it :o/ o14793-pro_0000033950 MSTN GDF8 Myostatin protein protein human Homo sapiens Human NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRR 24 266 609682C54333E2C9 gdf8_human Growth/differentiation factor 8 MSTN GDF8 Myostatin protein protein human Homo sapiens Human MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS mint homomint EBFF6129725E6AFA o14793-pro_0000033951 Growth/differentiation factor 8 Myostatin MSTN GDF8 protein protein human Homo sapiens Human DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 267 375 18A5970A2B035633 mstn-2 4 7 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1A mstn-3 2 7 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1A mstn-4 3 7 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) covalent binding covalent binding Figure 1A mstn-mstn-1 4 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1A mstn-mstn-2 2 8 unspecified role unspecified role neutral component neutral component purified purified 6 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure 1A mstn-5 3 8 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Figure 1A mstn-6 5 7 unspecified role unspecified role neutral component neutral component purified purified O14793:p.[Lys217Ala;Gln218Ala;Glu220Ala;Gln319Ala;Lys320Ala] Q319A,K320A,K217A,Q218A,E220A mutation mutation certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain E A Tue Sep 04 13:59:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln319Ala;Lys320Ala;Lys217Ala;Gln218Ala;Glu220Ala]' Tue Jun 30 17:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys217Ala;Gln218Ala;Glu220Ala;Gln319Ala;Lys320Ala]' binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3A, Table 1 mstn-mstn-3 1 8 unspecified role unspecified role neutral component neutral component purified purified 6 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure 2A