MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The distinctive cell division interactome of Neisseria gonorrhoeae. The distinctive cell division interactome of Neisseria gonorrhoeae. BMC microbiology 2017 imex curation Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca Accepted 2020-OCT-05 AT 16:18 BST AT 16:18 BST by KALPANAP BMC microbiology 2017 Only protein-protein interactions imex curation imex curation The distinctive cell division interactome of Neisseria gonorrhoeae. The distinctive cell division interactome of Neisseria gonorrhoeae. BMC microbiology 2017 imex curation Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca Accepted 2020-OCT-05 AT 16:18 BST AT 16:18 BST by KALPANAP BMC microbiology 2017 Only protein-protein interactions imex curation imex curation The distinctive cell division interactome of Neisseria gonorrhoeae. The distinctive cell division interactome of Neisseria gonorrhoeae. BMC microbiology 2017 imex curation Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca Accepted 2020-OCT-05 AT 16:18 BST AT 16:18 BST by KALPANAP BMC microbiology 2017 Only protein-protein interactions imex curation imex curation pbp2_neigo Probable peptidoglycan D,D-transpeptidase PenA penA Penicillin-binding protein 2 protein protein neigo Neisseria gonorrhoeae MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELVDVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS A495A788E465EFA2 a0a1d3fij4_neigo Cell division protein FtsQ WHOM_01246 ftsQ E8M63_08615 WHOF_00743 WHOF_01787C WHOM_01573C protein protein neigo Neisseria gonorrhoeae MWDNAEAMERLTRWLLVMMAMLLAASGLVWFYNSNHLPVKQVSLKGNLVYSDKKALGSLAKEYIHGNILRTDINGAQEAYRRYPWIASVMVRRRFPDTVEVVLTERKPVARWGDHALVDGEGNVFEARLDRPGMPVFRGAEGTSAEMLRRYDEFSTVLAKQGLGIKEMTYTARSAWNVVLDNGITVRLGRENEMKRLRLFTEAWQHLLRKNKNRLSYVDMRYKDGFSVRHAPDGLPEKESEE A2940C637C2FEE35 ftsz_neigo Cell division protein FtsZ ftsZ protein protein neigo Neisseria gonorrhoeae MEFVYDVAESAVSPAVIKVIGLGGGGCNAINNMVANNVRSVEFISANTDAQSLAKNHAAKRIQLGTNLTRGLGAGANPDIGRAAAQEDREAIEEAIRGANMLFITTGMGGGTGTGSAPVVAEIAKSLGILTVAVVTRPFSYEGKRVHVAQAGLEQLKEHVDSLIIIPNDKLMTALGEDVTMREAFRAADNVLRDAVAGISEVVTCPSEIINLDFADVKTVMSNRGIAMMGSGYAQGIDRARMATDQAISSPLLDDVTLDGARGVLVNITTAPGCLKMSELSEVMKIVNQSAHPDLECKFGAAEDETMSEDAIRITIIATGLKEKGAVDPTPEREVEAVAPSKQEQSHIVEGMIRTNRGIRTMNLTAADFDNQSVLDDFEIPAILRRQHNSDK 32CC508D868A3F60 a0a4t9uxi5_neigo ftsK_1 VT05_00329 protein protein neigo Neisseria gonorrhoeae MTEKSHKKTAKGRAGSPSPTSARNKKADNGARGNKVSERLKAVKELQKTETKKARPEHVVNLIADALWLMGLAATLYLAISLISFDMGDPSWSHSSPVVEDAANWGGLFGAYVADVGYYLFGWSFWWWIAAACVVLYKNFRLHAKQTENEAYNHKIAAAALFVLTVFSPVLEYFVLGGKYADSLPVGAGGMVGIRVGAVFAWLLGKSGSLLIILVVLLLSLSLLVQISWLEFLNGAGRAVQNRLSALSGKVMALRKRRPNTKTDGVDTQNTRRMVKEAKNITAKPVALPEGSSSNRKSVAVSVAPPPKIQPSLFEDNEVQQNGEYHKPTLNLLRIPDSEPVSINPAELERTAELIESKLAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQIVALSKDLARSMSLQSVRIVETIAGKNTMGIELPNDKRQDVMLSEILSSPVFAEAKSKLTVALGKDIAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIMSMLFKATPEEVRFIMIDPKMLELSIYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLEGFNQKVEQAKAAGKPLLNPFSLNLDEPEPLEKLPMIVVVIDELADLMMTERKAVEQQIARLAQKARAAGIHMIVATQRPSVDVVTGLIKANIPTRMAFTVQSKIDSRTILDQMGADELLKYGDSLFLQPGSAEPTRLQGTFVSDGEVHQVVNYVKSQAPADYIEGLLSGEAALETANIVNPNADSDELFDQAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALENAGIVSPSDFNGSRKILAHKDHL The sequence has been withdrawn from uniprot. FC6BE94DE7FCC0AD a0a1d3ieb2_neigo Cell division protein FtsA WHOM_01245 WHOM_01572C ftsA E8M63_08620 WHOF_00744 WHOF_01786C protein protein neigo Neisseria gonorrhoeae MEQQKRYISVLDIGTSKVLALIGEVQDDDKINIIGLGQAPSRGLRAGMVTNIDATVQAIRQAVNDAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPDQKILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIELCGLKSDQIMLQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLSKSLRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEIFGVVLGELQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQEMGGLSDRVRTPRFSTAIGLLHAACKLEGNLPQPENGTVQEREGGGGLLARLKRWIENNL 00BD97F23175D40E a0a1d3ii56_neigo Probable peptidoglycan glycosyltransferase FtsW WHOM_01250 WHOM_01577C ftsW E8M63_08595 Cell division protein FtsW Cell wall polymerase Peptidoglycan polymerase protein protein neigo Neisseria gonorrhoeae MKISEVLVKVGDGVHTLLLDRPIVRDGRKFDAPLLWMVVLMTAFGLLMIYSASVYLASKEGGDQFFYLTRQAGFVVAGLIASGFLWFLCRMRTWRRLVPWIFALSGLLLVAVLIAGREINGATRWIPLGPLNFQPTELFKLAVILYLASLFTRREEVLRSMESLGWQSIWRGTANLIMSATNPQARRETLEMYGRFRAIILPIMLVAFGLVLIMVQPDFGSFVVITVITVGMLFLAGLPWKYFFVLVGSVLGGMVLMITAAPYRVQRVVAFLDPWKDPQGAGYQLTHSLMAIGRGEWFGMGLGASLSKRGFLPEAHTDFIFAIIAEEFGFFGMCVLIFCYGWLVVRAFSIGKQSRDLGLTFNAYIASGIGIWIGIQSFFNIGVNIGALPTKGLTLPLMSYGGSSVFFMLISMMLLLRIDYENRRKMRGYRVE EA23966204CB4895 q50991_neigo tpc WHOF_00219 WHOF_00284C protein protein neigo Neisseria gonorrhoeae MSENKQNEVLTGYEQLKRRNRRRLVTASSLVAASCILLAAALSSDPADSNPAPQAGETGATESQTANTAQTPALKSAAENGETAADKPQDLAGEDKPSAADSEISEPENVGAPLVLINDRLEDSNIKGLEESEKLQQAETAKTEPKQAKQRAAEKVSATADSTDTVAVEKPKRSAEPKPQKAERTAEAKPKAKETKTAEKVADKPKTAAEKTKPDTAKSDSAVKEAKKADKAEGKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKAGKKAAIQAGYAEKERALSLQRKMKAAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKLRVHGIAGQVTNE 2317A107FC16F0D8 ftsw-1 3 9 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 ftsa-ftsz-7 3 8 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 f4 ftsa-ftsq-2 3 8 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 f5 ftsa-ftsz-12 3 8 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 f3 ftsz-ftsk_1-1 3 7 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 ftsa-ftsk_1-1 3 7 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 ftsa-ftsk_1-2 3 7 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 ftsa-ftsw-1 3 9 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 pena-ftsw-1 3 9 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 ftsz-ftsz-16 3 6 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association t4 f3 ftsa-ftsq-3 2 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association f2c ftsq-ftsa-1 2 8 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association f2a tpc-ftsa-1 2 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association f2e ftsq-ftsa-2 1 8 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association f1a ftsa-tpc-1 1 8 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association f1b