DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis of flagellin detection by NAIP5: A strategy to limit pathogen immune evasion. The structural basis of flagellin detection by NAIP5: A strategy to limit pathogen immune evasion. Science (New York, N.Y.) 2017 imex curation Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu Accepted 2019-MAY-09 AT 10:05 BST AT 10:05 BST by ORCHARD Science (New York, N.Y.) 2017 imex curation The structural basis of flagellin detection by NAIP5: A strategy to limit pathogen immune evasion. The structural basis of flagellin detection by NAIP5: A strategy to limit pathogen immune evasion. Science (New York, N.Y.) 2017 imex curation Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu Accepted 2019-MAY-09 AT 10:05 BST AT 10:05 BST by ORCHARD Science (New York, N.Y.) 2017 imex curation prgj_salty Protein PrgJ prgJ STM2872 protein protein salty Salmonella typhimurium MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS 7AC04EF792D72598 bir1e_mouse Baculoviral IAP repeat-containing protein 1e Naip5 Birc1e Naip-rs3 Neuronal apoptosis inhibitory protein 5 protein protein mouse Mus musculus Mouse MAEHGESSEDRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKERMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVRLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKRPEKMLRGGKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEIAQYIQSYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFANEELRMDMFKDWPQESPVGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSAEVIPTLQSQYALPEATETTRESNHGDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHISQPVQEALTIPEVFSNLNSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICAQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNRVRDIRLYLGTSLEIQEFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAAVCTDWIQNASAQDKFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDEKLTTLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESSSSFVSEHLLRLALIFAYESNTVAECSPFILQFLRGKTLALRVLNLQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQPPAIDEEYTSAFEHISEWRRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPKLEVQVNNTDAADQALLQVLMEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPNVLSVLPREFPNLLHMEKLSIQTSTESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLASCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKDQQFPDKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDDDSVIEIARAATSGGFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQCVSRLPSLIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE DIP protein Q9R016 original sequence version: 82 DIP protein Q9R016 original sequence version: 113 DIP protein Q9R016 original sequence version: 118 DIP protein Q9R016 original sequence version: 115 04C04877908103EE bir1f_mouse Baculoviral IAP repeat-containing protein 1f Naip6 Birc1f Naip-rs4 Neuronal apoptosis inhibitory protein 6 protein protein mouse Mus musculus Mouse MAEHGESSEDRISEIDYEFLAELSARFGMNLVQLAKSQEEEDHKERMKMKKGFNSQMRSEAKRLKTFESYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARLESFEDWPFYAHGTSPRALSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEIAQYIQDYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFTNEELRMDMFKDWPQESPVGFEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSAEVIPTLQSQYALPEATETTRESNHDDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDTYTKTSFCHMNLPEVCSSLGTDHLLGCDVSIISKHVSQPVQGALTIPEVFSNLSSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICTQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLFRTCLLIAVHTNRVRDIRPYLGTSLEIQEFPFYNTVFVLRKFFSHDIICVEKLIIYFSENKDLQGVYKTPLFVAAVCNDWNQNASAQDDFQDVTLFHSYMQYLSLKYKATAESLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDVKLTTFLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESFSSFVSEHLLRLALIFAYESNTVAECSPFILQFLRGRTLALRVLNLEYFWDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQPPAINEEYTSAFEHVSEWRRNFAQDEEIIKNYENIWPRALPDISEGYWNLSPKPCKIPKLEVQVNNMGPADQALLQVLMEVFSASQSIEFHLFNSSGFLESIRPALELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKELCVRLDGKPDVLSVLPEEFLNLHHMEKLSIRTSTESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMTALASCKKLREIEFSGQCFEAMTFVNILPNFVSLKILSLKGQQFADKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHDILDDESVIEIARAATSGSFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQMLNICRNIPGRIQVQATTVKALGHCVSRLPSLTRLGMLSWLLDEEDMKVINDVKERHPQSKRLTIFWKWIVPFSPVVLE DIP protein Q9JIB6 original sequence version: 73 q5zvv0_legph Flagellin fliC lpg1340 protein protein legph Legionella pneumophila subsp. pneumophila MAQVINTNVASLTAQRNLGVSGNMMQTSIQRLSSGLRINSAKDDAAGLAISQRMTAQIRGMNQAVRNANDGISLAQVAEGAMQETTNILQRMRELSVQAANSTNNSSDRSSIQSEISQLKSELERIAQNTEFNGQRILDGSFSGASFQVGANSNQTINFSIGSTKASSLGGIATATGTEVAGAAAADITIAIGGGAATSINSSANFTGALNGQDATSAYAKAAAINDAGIGGLSVTASTSGTQAVGAIGGTAGDTYNLTINGVAIYTNLNVATALTNSDLRDAINGVSNQTGVVASLNGGNMTLTAADGRNITVTESGTGFTAGTDGLTVTGGAFDGALRGTLSISAVDTIAIGGTVANIGLSANISKDTVGIDSLDVSTASGAQTAIKRIDAALNSVNSNRANMGALQNRFESTIANLQNVSDNLSAARSRIQDADYAAEMASLTKNQILQQAGTAMLAQANSLPQSVLSLLGR 5D8E2E4B2A1F20AD nlrc4_mouse NLR family CARD domain-containing protein 4 Nlrc4 Card12 Ipaf Caspase recruitment domain-containing protein 12 Ice protease-activating factor protein protein mouse Mus musculus Mouse MNFIRNNRRALIQRMGLTVTKQICDDLFALNVLNNQEANVIYCEPLEQEAARKIIHMTMQKGSAACNLFLKSLENWDYFVYQDLTGQNLSYQVTEEDLNVLAQNLKDLYNSPAFLNFYPLGEDIDIIFNLEKTFTEPIMWKKDHRHHRVEQLTLGSLLEALKSPCLIEGESGKGKSTLLQRIAMLWASGGCRALKGFRLVFFIHLRSARGGLFETLYDQLLNIPDFISKPTFKALLLKLHKEVLFLLDGYNEFHPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRHVGALTAEVGDMTEDSAKDLIEAVLVPDQVERLWAQIQESRCLRNLMKTPLFVVITCAIQMGRQEFQAHTQTMLFQTFYDLLIQKNSHRYRGGASGDFARSLDYCGDLALEGVFAHKFDFEPEHGSSMNEDVLVTIGLLCKYTAQRLKPTYKFFHKSFQEYTAGRRLSSLLTSKEPEEVSKGNSYLNKMVSISDITSLYGNLLLYTCGSSTEATRAVMRHLAMVYQHGSLQGLSVTKRPLWRQESIQSLRNTTEQDVLKAINVNSFVECGINLFSESMSKSDLSQEFEAFFQGKSLYINSENIPDYLFDFFEYLPNCASALDFVKLDFYERATESQDKAEENVPGVHTEGPSETYIPPRAVSLFFNWKQEFKTLEVTLRDINKLNKQDIKYLGKIFSSATNLRLHIKRCAAMAGRLSSVLRTCKNMHTLMVEASPLTTDDEQYITSVTGLQNLSIHRLHTQQLPGGLIDSLGNLKNLERLILDDIRMNEEDAKNLAEGLRSLKKMRLLHLTHLSDIGEGMDYIVKSLSEESCDLQEMKLVACCLTANSVKVLAQNLHNLIKLSILDISENYLEKDGNEALQELIGRLGVLGELTTLMLPWCWDVHTSLPKLLKQLEGTPGLAKLGLKNWRLRDEEIKSLGEFLEMNPLRDLQQLDLAGHCVSSDGWLYFMNVFENLKQLVFFDFSTEEFLPDAALVRKLSQVLSKLTLLQEVKLTGWEFDDYDISAIKGTFKLVTA DIP protein Q3UP24 original sequence version: 86 DIP protein Q3UP24 original sequence version: 90 DIP protein Q3UP24 original sequence version: 87 bir1b_mouse Baculoviral IAP repeat-containing protein 1b Naip2 Birc1b Naip-rs6 Neuronal apoptosis inhibitory protein 2 protein protein mouse Mus musculus Mouse MAAQGEAVEEIICEFDDDLVSELSTLLRVDALSVLKRQQEEDHKTRMKMKKGFNSQMRSEAKRLKTFETYDKFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLILFSTRLRKLPIENHKKLRPECEFLLGKDVGNIGKYDIRVKSPEKMLRGDKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSPEEITQYVQSYEGFLHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELRMDTFKDWPHESPGAVEALVKAGLFYTGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKFFPNCVFLQTLKSSAEVIPALQSHCALPEAMETTSESNHDDAAAVHSTVVDVSPSEAQELEPASSLVSVLCRDQDHSEAQGRGCASSGTYLPSTDLGQSEAQWLQEARSLSEQLRDTYTKATFRHMNLPEVYSSLGTDHLLSCDVSIISKHISQPVQGSLTIPEVFSNLNSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPGQELAKIICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNKVRGIRPYLDTSLEIKEFPFYNTVSVLRKLFSHDIMRVRKFINYFGFHEELQGIHKTPLFVAAVCTDWFKNPSDQPFQDVALFKAYMQYLSLKHKGAAKPLQATVSSCGQLALTGLFSSCFEFNSDNLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQINSPLKAMSIYHTFLKYVSSHPSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPEALLWIECLRGLWQLSPESFSLFISENLLRICLNFAHESNTVAACSPVILQFLRGRTLDLKVLSLQYFWDHPETLLLLKSIKISLNGNNWVQRIDFSLIEKSFEKVQPPTIDQDYAIAFQPINEVQKNLSEKKHIIKKYEDMKHQIPLNISTGYWKLSPKPYKIPKLEVQVTNTGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPALELSKASVTKCSMSRLELSREDQKLLLTLPTLQSLEVSETNQLPDQLFHNLHKFLGLKELCVRLDSKPDVLSVLPGEFPNLHHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCNFLSNCEPLMTVLASCKKLREIEFSGRCFEAMTFVNILPNFVFLKILNLRDQQFPDKETSEKFAQALGSLRNLEKLFVPTGDGIHQVAKLIVRQCLQLPCLRVLVFAETLDDDSVLEIAKGATRGGFQKLENLDLTLNHKITEEGYRNFFQVLDNLPNLKNLDISRHIPECIQIQAITVKALGQCVSRLPSLTRLGMLSWLLDEEDIKVINDVKERHPQSKRLTVHWRWVVPFSPVIQK DIP protein Q9QUK4 original sequence version: 89 DIP protein Q9QUK4 original sequence version: 128 flic-naip5-8 1 4 unspecified role unspecified role neutral component neutral component purified purified FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role neutral component neutral component purified purified 6myc-tag 6myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role neutral component neutral component purified purified GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q3UP24:p.[Phe79Ala;Asp83Ala] p.Phe79Ala,Asp83Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain D A Mon Jul 30 10:20:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'F79A,D83A' Tue Jun 30 18:15:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe79Ala;Asp83Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig 1 naip5-flic-4 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S7A naip5-flic-1 2 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5ZVV0:p.Arg31_Ser33delinsAlaAlaAla 31-33A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain RLS AAA Tue Sep 04 19:04:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg31Ala;Leu32Ala;Ser33Ala]' Tue Jun 30 17:31:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg31_Ser33delinsAlaAlaAla' 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R016:p.Phe32_Val34delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain FQV AAA Thu Jul 11 16:45:15 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe32Ala;Gln33Ala;Val34Ala]' Tue Jun 30 18:35:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32_Val34delinsAlaAlaAla' Q9R016:p.Gln837_Thr838delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain QT AA Thu Jul 11 16:51:38 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln837Ala;Thr838Ala]' Tue Jun 30 16:09:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln837_Thr838delinsAlaAla' Q9R016:p.Phe839_Leu840delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain FL AA Thu Jul 11 17:47:10 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe839Ala;Leu840Ala]' Tue Jun 30 19:42:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe839_Leu840delinsAlaAla' 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig2B Mutation Asn107Ala;Ser108Ala decreased the ability of NAIP5 to bind flagellin proteins but had no effect on interaction with NLRC4 Mutation Trp841Ala;Phe842Ala decreased the ability of NAIP5 to bind the N-65 flagellin protein but had no effect on interaction with the C-35 protein or NLRC4 Mutation Gln843Ala;Phe844Ala decreased the ability of NAIP5 to bind the N-65 and C-35 flagellin proteins but had no effect on interaction with NLRC4 Mutation Leu848Ala;Trp849Ala decreased the ability of NAIP5 to bind flagellin proteins but had no effect on interaction with NLRC4 flic-flic-1 2 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Supp Fig 7B naip5-flic-2 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Arg31Ala,Leu32Ala,Ser33Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Mon Jul 30 10:05:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'R31A/L32A/S33A' Tue Jun 30 16:48:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu470Ala;Leu472Ala;Leu473Ala]' FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Supp Fig 9A naip5-flic-3 2 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5ZVV0:p.[Arg31Ala;Leu32Ala;Ser33Ala] p.Arg31Ala,Leu32Ala,Ser33Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain S A Mon Jul 30 10:45:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'R31A/L32A/S33A' Tue Jun 30 20:24:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg31Ala;Leu32Ala;Ser33Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Leu470Ala,Leu472Ala,Leu473Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Mon Jul 30 10:11:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'L470A/L472A/L473A' Tue Jun 30 15:49:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu470Ala;Leu472Ala;Leu473Ala]' FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Supp. Fig 9A naip5-nlrc4-3 2 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R016:p.Gly847Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G K Tue Jun 30 17:50:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly847Lys' Q9R016:p.Tyr974_Glu975delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain YE AA Thu Jul 11 16:56:37 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr974Ala;Glu975Ala]' Tue Jun 30 15:45:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr974_Glu975delinsAlaAla' Q9R016:p.Ile626_Ile627delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain II AA Thu Jul 11 17:51:15 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile626Ala;Ile627Ala]' Tue Jun 30 19:14:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile626_Ile627delinsAlaAla' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig 2F naip6-flic-1 2 5 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain FlaN65-FlaC35 Fla440-475 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9B naip6-flic-2 2 5 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaN65 Fla1-65 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range FlaC35 Fla441-475 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Leu470Ala,Leu472Ala,Leu473Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Tue Sep 04 18:22:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'L470A/L472A/L473A' Tue Jun 30 18:41:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu470Ala;Leu472Ala;Leu473Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9B naip2-nlrc4-6 2 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63-C35 PrgJN63-C35 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9C naip2-nlrc4-7 2 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain p.Leu98_Ser101del PrgJC38_dC4 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain LLRS . human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P41785:p.[Leu33Ala;Leu34Ala] p.Leu33Ala,Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Tue Sep 04 14:10:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'L33AL34A' Tue Jun 30 17:52:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu33Ala;Leu34Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9C nlrc4-naip2-1 2 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9D prgj-naip2-1 2 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig S9D naip5-flic-6 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R016:p.Gln837_Thr838delinsAlaAla Q837A/T838A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain QT AA Tue Sep 04 15:36:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln837Ala;Thr838Ala]' Tue Jun 30 19:48:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln837_Thr838delinsAlaAla' Q9R016:p.Phe839_Leu840delinsAlaAla F839A/L840A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain FL AA Tue Sep 04 19:15:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe839Ala;Ley840Ala]' Tue Jun 30 18:13:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe839_Leu840delinsAlaAla' Q9R016:p.Trp841_Phe842delinsAlaAla W841A/F842A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WF AA Tue Sep 04 16:08:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp841Ala;Phe842Ala]' Tue Jun 30 16:08:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp841_Phe842delinsAlaAla' Q9R016:p.Gln843_Phe844delinsAlaAla Q843A/F844A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain QF AA Tue Sep 04 15:42:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln843Ala;Phe844Ala]' Tue Jun 30 19:08:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln843_Phe844delinsAlaAla' Q9R016:p.Gly847Lys G847K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G K Tue Jun 30 19:05:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly847Lys' Q9R016:p.Leu848_Trp849delinsAlaAla L848A/W849A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LW AA Tue Sep 04 17:36:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu848Ala;Trp849Ala]' Tue Jun 30 16:16:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu848_Trp849delinsAlaAla' Q9R016:p.Cys1329_Arg1330delinsAlaAla C1329A/R1330A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain CR AA Tue Sep 04 17:43:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1329Ala;Arg1330Ala]' Tue Jun 30 15:49:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys1329_Arg1330delinsAlaAla' Q9R016:p.[His1360Ala;Leu1362_Ser1363delinsAlaAla] H1360A/L1362A/S1363A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain LS AA Tue Sep 04 14:33:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His1360Ala;Ley1362Ala;Ser1363Ala]' Tue Jun 30 18:45:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His1360Ala;Leu1362_Ser1363delinsAlaAla]' Q9R016:p.Tyr974_Glu975delinsAlaAla Y974A/E975A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain YE AA Tue Sep 04 19:29:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr974Ala;Glu975Ala]' Tue Jun 30 18:18:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr974_Glu975delinsAlaAla' Q9R016:p.Ile626_Ile627delinsAlaAla I626A/I627A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain II AA Tue Sep 04 16:55:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.{Ile626Ala;Ile627Ala]' Tue Jun 30 18:47:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile626_Ile627delinsAlaAla' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig 2F naip5-nlrc4-4 2 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q3UP24:p.Asp125Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 17:53:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp125Ala' Q3UP24:p.Ile127Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 19:19:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile127Ala' Q3UP24:p.Met349Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Tue Jun 30 16:03:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met349Ala' Q3UP24:p.Asn116Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 17:33:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn116Ala' Q3UP24:p.Tyr118Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 15:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr118Ala' Q3UP24:p.[Phe79Ala;Asp83Ala;Arg288Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Thu Jul 11 17:58:22 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe79Ala;Asp83Ala;Arg288Ala' Tue Jun 30 18:37:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe79Ala;Asp83Ala;Arg288Ala]' Q3UP24:p.Ile124Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 17:15:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile124Ala' n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q3UP24:p.Leu120Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 19:59:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu120Ala' Q3UP24:p.Asp123Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 16:14:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp123Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp Fig 5B naip5-flic-7 2 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.Leu12Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 18:26:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu12Ala' gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5ZVV0:p.Leu18Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 19:39:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu18Ala' Q5ZVV0:p.Met25Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 16:33:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met25Arg' Q5ZVV0:p.Leu32Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Thu Jul 11 17:55:10 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.leu32Arg' Tue Jun 30 17:22:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GFP tag GFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Supp Fig 7A