DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Nature 2017 imex curation Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_th17 Mouse Thelper 17 cells t-cell_th17 T-helper 17 cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu Accepted 2018-JUL-30 AT 08:55 BST AT 08:55 BST by ORCHARD Nature 2017 imex curation Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Nature 2017 imex curation Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu Accepted 2018-JUL-30 AT 08:55 BST AT 08:55 BST by ORCHARD Nature 2017 imex curation Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Reversing SKI-SMAD4-mediated suppression is essential for TH17 cell differentiation. Nature 2017 imex curation Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY., Zhang S., Takaku M., Zou L., Gu AD., Chou WC., Zhang G., Wu B., Kong Q., Thomas SY., Serody JS., Chen X., Xu X., Wade PA., Cook DN., Ting JPY., Wan YY. wany@email.unc.edu Accepted 2018-JUL-30 AT 08:55 BST AT 08:55 BST by ORCHARD Nature 2017 imex curation smad4_mouse Mothers against decapentaplegic homolog 4 Smad4 Dpc4 Madh4 Deletion target in pancreatic carcinoma 4 homolog SMAD family member 4 protein protein mouse Mus musculus Mouse MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein P97471 original sequence version: 79 DIP protein P97471 original sequence version: 150 4FBDF5DED4442F86 ski_mouse Ski oncogene Ski Proto-oncogene c-Ski protein protein mouse Mus musculus Mouse MEAAAAGRGGFQQPGLQKTLEQFHLSSMSSLGGPAVSRRAGQEAYKKESAKEAGAATVPAPVPTAAEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYANKYKRRVPRVSEPPASIRPKTDDTSSQSPASSEKDKQSTWLRTLAGSSNKSLGCTHPRQRLSAFRPWSPAVSASEKETSPHLPALIRDSFYSYKSFETAVAPNVALAPPTQQKVVNSPPCTTVVSRAPEPLTTCIQPRKRKLTLDTAGAPDMLTPVAAAEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLSSPGMHAPPVVAPDAAAHVDAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLTAALQAKRTLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRVRLKRELEQARQVRVCDKGCEAGRLRAKYSAQVEDLQAKLQHAEADREQLRADLLREREAREHLEKVVRELQEQLRPRPRPEHPGGESNAELGP DIP protein Q60698 original sequence version: 91 smad4-ski-2 3 5 mudpit multidimensional protein identification technology mudpit ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey native native mouse Mus musculus Mouse 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse physical association physical association Extended Data Fig 3a smad4-ski-3 1 5 unspecified role unspecified role prey prey native native 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97471:p.Tyr429Ala Y429A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 18:23:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr429Ala' P97471:p.Ala432Glu A432E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A E Tue Jun 30 18:31:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala432Glu' physical association physical association Fig 3c,f smad4-ski-4 2 5 mudpit multidimensional protein identification technology mudpit ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey native native mouse Mus musculus Mouse 4 unspecified role unspecified role bait bait native native mouse Mus musculus Mouse physical association physical association Extended Data Fig 3a