DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu cGAS senses long and HMGB/TFAM-bound U-turn DNA by forming protein-DNA ladders. cGAS senses long and HMGB/TFAM-bound U-turn DNA by forming protein-DNA ladders. Nature 2017 imex curation Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de Accepted 2018-JUL-31 AT 09:12 BST AT 09:12 BST by ORCHARD Nature 2017 imex curation cGAS senses long and HMGB/TFAM-bound U-turn DNA by forming protein-DNA ladders. cGAS senses long and HMGB/TFAM-bound U-turn DNA by forming protein-DNA ladders. Nature 2017 imex curation Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de Accepted 2018-JUL-31 AT 09:12 BST AT 09:12 BST by ORCHARD Nature 2017 imex curation cgas_mouse Cyclic GMP-AMP synthase Cgas Mb21d1 Mab-21 domain-containing protein 1 2'3'-cGAMP synthase protein protein mouse Mus musculus Mouse MEDPRRRTTAPRAKKPSAKRAPTQPSRTRAHAESCGPQRGARSRRAERDGDTTEKPRAPGPRVHPARATELTKDAQPSAMDAAGATARPAVRVPQQQAILDPELPAVREPQPPADPEARKVVRGPSHRRGARSTGQPRAPRGSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL 9FDA84DF5E4859CA q00059-1 Transcription factor A, mitochondrial Mitochondrial transcription factor 1 Transcription factor 6 Transcription factor 6-like 2 TFAM TCF6 TCF6L2 protein protein human Homo sapiens Human MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC 81F00CFA12DA4924 q8n884-1 Isoform 1 of Cyclic GMP-AMP synthase CGAS C6orf150 MB21D1 protein protein human Homo sapiens Human MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF 808FF6F9F3BF8C50 cgas-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 10 direct interaction direct interaction Fig 1d-e, Table S3 cgas-tfam-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Extended Data Fig 9e