UniProt UniProt http://www.uniprot.org Regulation of the interaction between the neuronal BIN1 isoform 1 and Tau proteins - role of the SH3 domain. Regulation of the interaction between the neuronal BIN1 isoform 1 and Tau proteins - role of the SH3 domain. The FEBS journal 2017 imex curation Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I., Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I. I have not included the CLAP domain data, as this is a an intra-molecular interaction, and would end up suggesting a homodimer which does not appear to exist. isabelle.landrieu@univ-lille1.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I., Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I. I have not included the CLAP domain data, as this is a an intra-molecular interaction, and would end up suggesting a homodimer which does not appear to exist. Origin for BIN1 taken from sequence length given in Fig. 1. Origin of MAPT taken from PMID:30386294 by the same author isabelle.landrieu@univ-lille1.fr Accepted 2019-MAR-07 AT 08:28 GMT AT 08:28 GMT by LIVIAP The FEBS journal 2017 Only protein-protein interactions imex curation imex curation I don't understand the comment about the Kd - 12umol is what I've entered. Regulation of the interaction between the neuronal BIN1 isoform 1 and Tau proteins - role of the SH3 domain. Regulation of the interaction between the neuronal BIN1 isoform 1 and Tau proteins - role of the SH3 domain. The FEBS journal 2017 imex curation Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I., Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I. I have not included the CLAP domain data, as this is a an intra-molecular interaction, and would end up suggesting a homodimer which does not appear to exist. isabelle.landrieu@univ-lille1.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I., Malki I., Cantrelle FX., Sottejeau Y., Lippens G., Lambert JC., Landrieu I. I have not included the CLAP domain data, as this is a an intra-molecular interaction, and would end up suggesting a homodimer which does not appear to exist. Origin for BIN1 taken from sequence length given in Fig. 1. Origin of MAPT taken from PMID:30386294 by the same author isabelle.landrieu@univ-lille1.fr Accepted 2019-MAR-07 AT 08:28 GMT AT 08:28 GMT by LIVIAP The FEBS journal 2017 Only protein-protein interactions imex curation imex curation I don't understand the comment about the Kd - 12umol is what I've entered. p10636-8 Microtubule-associated protein tau Tau-4 MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 2N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636-8 original sequence version: 206 DIP protein P10636-8 original sequence version: 203 DIP protein P10636-8 original sequence version: 166 DIP protein P10636-8 original sequence version: 218 835A8706D847A8CC o00499-9 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP 08C5B23D79252350 o00499-1 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP 0FF1956F0C7E3B50 bin1-mapt-9 1 3 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3 bin1-mapt-10 1 3 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3, 4A bin1-mapt-11 2 3 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 4B