IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". Cells were cross linked with DSP (dithiobis(succinimidyl propionate) before IP with anti-WDR24. The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK SZT2 dictates GATOR control of mTORC1 signalling. SZT2 dictates GATOR control of mTORC1 signalling. Nature 2017 imex curation Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Peng M., Yin N., Li MO. Results from Amino acid binding assay have not been included as an immunoprecipitated preparation is used; other proteins may also be pulled down in the same preparation and may actually be the active factor in this assay. (Extended fig 3 C/D). Results from Extended data 4 using anti-S6K antibody have not been included due to lack of specificity of this antibody. (found when looking for SESN1 interactions - ? new interactions.) I have assumed in figs 2C/2E and possibly Supp 2 F/G +elsewhere, that they have used 293T cells, although no cell line is mentioned! 293T is the only cell line mentioned with a "knock-in allele of SZT2". The authors have stated that Flag-Sesn2 was of mouse origin and Flag-WDR24 was of human origin, and that the cell lines used in Figures 2C and 2E, Extended Data Figures 2/3 were all human HEK293T. lim@mskcc.org Accepted 2018-JUN-21 AT 15:12 BST AT 15:12 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation altered; I have added Biological Role as Ancillary -hope this is OK sec13_human Protein SEC13 homolog SEC13 D3S1231E SEC13L1 SEC13R SEC13-related protein SEC13-like protein 1 GATOR complex protein SEC13 SEC13A protein protein human Homo sapiens Human MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ 18E29627D87FB3DD wdr24_human GATOR complex protein WDR24 WDR24 C16orf21 WD repeat-containing protein 24 JFP7 protein protein human Homo sapiens Human MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS DIP protein Q96S15 original sequence version: 119 6C109240F6251898 o75140-4 GATOR complex protein DEPDC5 DEPDC5 KIAA0645 DEP domain-containing protein 5 protein protein human Homo sapiens Human MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFTPRIKLAGKKPASEKAKNGRDTSLGSPKESENALPIQVDYDAYDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSSLGYTSTRDVLENMMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSGQRDPTHSSAELLELAYHEAAGRHSNSRQPGDGMSFLNFSGTEELSVGLLSNSGAGMNPRTQNKDSLEDSVSTSPDPILTLSAPPVVPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADIDRRDEDGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGLVSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDSEFVSCWVEFSHERLEEYKWNYLDQYICSAGSEDFSLIESLKFWRTRFLLLPACVTATKRITEGEAHCDIYGDRPRADEDEWQLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGPISTHSLESTAPPVGKKGTSALSALLEMEASQKCLGEQQAAVHGGKSSAQSAESSSVAMTPTYMDSPRKVSVDQTATPMLDGTSLGICTGQSMDRGNSQTFGNSQNIGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILEAMKHPSTGVQLLSEQKGLSPYCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIVTDKEPDRVAMQQPATTWHTAGVDDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISCLLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFGFVQDKYSASAFNFPAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTSCLEKMHASAP No experimental confirmation available. 370A819D424914D4 mio_human GATOR complex protein MIOS MIOS Missing oocyte meiosis regulator homolog protein protein human Homo sapiens Human MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP DIP protein Q9NXC5 original sequence version: 111 481D3AA0C9A3A1CB lamp1_human Lysosome-associated membrane glycoprotein 1 CD107 antigen-like family member A LAMP1 protein protein human Homo sapiens Human MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI DIP protein P11279 original sequence version: 147 3E0A285744DD6588 nprl3_human GATOR complex protein NPRL3 MARE NPRL3 C16orf35 CGTHBA Alpha-globin regulatory element-containing gene protein Protein CGTHBA -14 gene protein Nitrogen permease regulator 3-like protein protein protein human Homo sapiens Human MRDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDGDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCKLARDLKEAYDSLCTSGVVRLHINSWLEVSFCLPHKIHYAASSLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPIDCSPALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLAEQFSHQFPSHDLPSVLAKFSLPVSLSEFRNPLAPAVQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSEEEPRPREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLNQRMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPVIAVFQALLP DIP protein Q12980 original sequence version: 105 44BEF42AA7F2841D rragb_human Ras-related GTP-binding protein B RRAGB protein protein human Homo sapiens Human MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR DIP protein Q5VZM2 original sequence version: 89 0D32F7D86E2A00DE rragc_human Ras-related GTP-binding protein C GTPase-interacting protein 2 TIB929 RRAGC protein protein human Homo sapiens Human MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI DIP protein Q9HB90 original sequence version: 120 DIP protein Q9HB90 original sequence version: 109 35B3171253CC69CF seh1_human Nucleoporin SEH1 Nup107-160 subcomplex subunit SEH1 SEH1L SEC13L SEH1 SEC13-like protein GATOR complex protein SEH1 protein protein human Homo sapiens Human MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS FB9ED2440C4EC9AB nprl2_human GATOR complex protein NPRL2 NPRL2 Gene 21 protein TUSC4 Tumor suppressor candidate 4 Nitrogen permease regulator 2-like protein protein protein human Homo sapiens Human MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAMEKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVSMEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICWK DIP protein Q8WTW4 original sequence version: 108 5ECA201CE073F964 wdr59_human GATOR complex protein WDR59 WDR59 KIAA1923 WD repeat-containing protein 59 FP977 protein protein human Homo sapiens Human MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTASHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCLEPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHKSLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGVYCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVCPTGCGCHCLLESTF 72F651A38EA51CBA lamp2_human Lysosome-associated membrane glycoprotein 2 LAMP2 CD107 antigen-like family member B LGP-96 protein protein human Homo sapiens Human MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF 9E08E3B62D58F454 depd5_human GATOR complex protein DEPDC5 DEPDC5 DEP domain-containing protein 5 KIAA0645 protein protein human Homo sapiens Human MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFTPRIKLAGKKPASEKAKNGRDTSLGSPKESENALPIQVDYDAYDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSSLGYTSTRDVLENMMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSGQRDPTHSSAELLELAYHEAAGRHSNSRQPGDGMSFLNFSGTEELSVGLLSNSGAGMNPRTQNKDSLEDSVSTSPDPILTLSAPPVVPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADIDRRDEDGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGLVSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDSEFVSCWVEFSHERLEEYKWNYLDQYICSAGSEDFSLIESLKFWRTRFLLLPACVTATKRITEGEAHCDIYGDRPRADEDEWQLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGPISTHSLESTAPPVGKKGTSALSALLEMEASQKCLGEQQAAVHGGKSSAQSAESSSVAMTPTYMDSPRKDGAFFMEFVRSPRTASSAFYPQVSVDQTATPMLDGTSLGICTGQSMDRGNSQTFGNSQNIGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILEAMKHPSTGVQLLSEQKGLSPYCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIVTDKEPDRVAMQQPATTWHTAGVDDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISCLLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFGFVQDKYSASAFNFPAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTSCLEKMHASAP 19664228B566A080 szt2_human KICSTOR complex protein SZT2 SZT2 C1orf84 KIAA0467 Seizure threshold 2 protein homolog protein protein human Homo sapiens Human MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLSHLHQTVQATPQEMLLQSEQELEVLSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDEVFHALSRCLGGLLRPFRVPGSCIDFQPEIYVTIQAYSSIIGLQSHQVLVQGCLLDPSQREVFLQQIYEQLCLFEDKVATMLQQQYDPQSQAEDQSPDSGDLLGRKVGVSMVTADLGLVSMIRQGILALQLLPSNSSAGIIVITDGVTSVPDVAVCETLLNQLRSGTVACSFVQVGGVYSYDCSFGHVPNVELMKFIAMATFGSYLSTCPEPEPGNLGLTVYHRAFLLYSFLRSGEALNPEYYCGSQHRLFNEHLVSASSNPALALRRKKHTEKEVPADLVSTVSVRLREGYSVREVTLAKGGSQLEVKLVLLWKHNMRIEYVAMAPWPLEPEGPRVTRVEVTMEGGYDILHDVSCALRQPIRSLYRTHVIRRFWNTLQSINQTDQMLAHLQSFSSVPEHFTLPDSTKSGVPLFYIPPGSTTPVLSLQPSGSDSSHAQFAAYWKPVLSMDANSWQRWLHMHRLVLILEHDTPIPKHLHTPGSNGRYSTIQCRISHSSLTSLLRDWSSFVLVEGYSYVKLLSSAPDQPPNSFYMVRIISKAPCMVLRLGFPIGTPAPARHKIVSGLREEILRLRFPHRVQSKEPTPKVKRKGLGGAGGGSSPSKSPPVLGPQQALSDRPCLVVLHKPLDKLLIRYEKLPLDYRAPFLLTLEPPGPLPLVSGRSASSSLASLSRYLYHQRWLWSVPSGLAPALPLSAIAQLLSILTEVRLSEGFHFACSGEGIINMVLELPIQNEPPGQAAAEEKHTCVVQYILFPPHSTSTKDSFSTDDDNDVEVEALEGDSELNLVTEVWVEPQYGRVGPGPGIWKHLQDLTYSEIPQALHPRDAACIGSMLSFEYLIQLCQSKEWGPLPPEPRVSDGLDQGGDTCVHEIPFHFDLMGLLPQCQQLQMFFLLLAREPEGVPFAEGSCPANDMVLCLLHSCLGQELSDREIPLTPVDQAAFLSEVLRRTCHVPGAEGPLLGVHGIPKEQAVGSTQATGDSAFTSLSVGLPETLKPLISAQPPQWRCYARLVNPQHVFLTFLPATFSDVQRLAACGLEGPPQEETKPKFGDWSGAPSLKDLGGTGIKATKSHVPVLSVTLASDNAQNQGELSPPFRRDLQAYAGRQASQTESADGPRTRCPVYIYSCSLEALREQMVGMQPPQAPRDLIFRTQFLDHPSPSSAWMEPRYKEAANHCALLQEHAQRCYVRGLFRSLQQAQSVTSQDLLTAVDACEELLQEIDITPFLLALCGHTWGLPHAPPSPGPLSPGPFSSSMEEGAEPRERAILASESSIETEDLSEPEFQSTRVPGIPDPGPEISLTDVCQLRGEAHGALHSVIQEKFLEISRLHFRTVPSNPHYFFYCPPSSRREDEGPRDTVDRKISDLEFSEAELMGEEGDTSACCVVTESDPELEVEYRESRESDLGPAGLDSASLSDVDTVNPDEDSFSILGGDSPTGPESFLHDLPPLFLHLTCSVRLRGQHSSVPVCSLPTCLGQVLSSLEGPPVGGRVPLRDLSVTLDVFMLTLPLEVELPTASDPQHHRSTSESSASFPRSPGQPSSLRSDDGLGPPLPPPEEERHPGLSNLATPHRLAIETTMNEIRWLLEDEMVGALRRGGIPQSPALHRAAAHIHSSPGRSTCLRQTLPLSFVFGPERSLTQFKEEFRRLHLPGHVLLEDPDSGFFFVAAGQQPGGSHGEPSSAAWAWHSHEDRAEGIEGETLTASPQAPGSPEDSEGVPLISLPRVPQGGSQPGPSRGLSLMSSQGSVDSDHLGYDGGSSGSDSEGPNDTLGEKAPFTLRTPPGPAPPQPSLSGLPGPCLPDFWLIVRVLQDRVEVYAHARSLIREDGGPGTECRHLQQLLVRRVGEICREVNQRLLLQDLHDSHVCNSLLVAESEEDLWRSETPFHSRQRAPLPSDDYAADESCAPRGYLAATMQFVPGHFSCDVVWGTVIRVHSRLKMGPSMGVSRAIQALRSVLNAFSVVNRKNMFVYQERATKAVYYLRLLETSCSDRPWKGDALPPSLALSRSQEPIYSEEASGPRSPLDMVSSRSSDAARPVGQVDRHIQLLVHGVGQAGPEITDELVRVLCRRLDEATLDVITVMLVRNCKLTPADVEFIQPPGSLPSEVLHLALPTSCRPWLPALAWYLRQNLLIFLHSPKYTDSNSRNHFQHPLPPQGGLPDLDIYLYNKPGGQGTGGKGVACITLAFVDEGGAPLSLALWPPSSPGPPDPLREEEFEQLTQVIRCPVVVDSSSAQNGAPRLRLDVWEKGNISIVQLEEKLRGAARQALADAIIELQLLPASLCTEDTPTGSLRNGSLETKSSAGRASTFPPAPVPGEPVTPPSKAGRRSFWDMLSKTECGDLGSPKTTDDIVLDRPEDTRGRRRHKTESVRTPGGAERAPGSDSGAQRQKRRTTQLEEGEVGTLHPVFARVAQRWMEFMVQIGCASVSRSSAHMVSRFLLPSILSEFTALVTSMAGDTSVRIFEQHLGSEPEIFGPCSPGQLGPSPRPAAERHLLLLGRNFLQWRRPTQQAAKAMQRFEPGGDGSSGRNAPRQRLLLLEVVDKKLQLLTYNWAPDLGAALGRALVRLVQWQNARAHLIFCLLSQKLGLFHHYGQLDFPVRDEKEPNPFLLPTMEVETLIRSASPPLSREQGRLSGSSRGGGPLPLDTFPFDEALRDITAARPSSVLGPVPRPPDPVTYHGQQFLEIKMAERRELERQMKMENLFVTWQQRSTPATMPISAGELETLKQSSRLVHYCATAMLFDPAAWLHGPPETSGPPDGQRRHRPESGSGSREAPTSCESLDVSPPGAREEPWLKELSLAFLQQYVQYLQSIGFVLVPLRPPSPARSTSRPRAMAILGTEGRGSFSCPKTKTDGSPKSTSSPVTTYHLQRALPGGIILMELAFQGCYFCVKQFALECSRIPMGQAVNSQLSMLFTEECDKVRDLMHVHSFSYDFHLRLVHQHVLGAHLVLRHGYHLTTFLRHFLAHHPDGPHFGRNHIYQGTLELPTPLIAAHQLYNYVADHASSYHMKPLRMARPGGPEHNEYALVSAWHSSGSYLDSEGLRHQDDFDVSLLVCHCAAPFEEQGEAERHVLRLQFFVVLTSQRELFPRLTADMRRFRKPPRLPPEPEAPGSSAGSPGEASGLILAPGPAPLFPPLAAEVGMARARLAQLVRLAGGHCRRDTLWKRLFLLEPPGPDRLRLGGRLALAELEELLEAVHAKSIGDIDPQLDCFLSMTVSWYQSLIKVLLSRFPQSCRHFQSPDLGTQYLVVLNQKFTDCFVLVFLDSHLGKTSLTVVFREPFPVQPQDSESPPAQLVSTYHHLESVINTACFTLWTRLL E65E415FA8C55BC1 sesn2_human Sestrin-2 SESN2 SEST2 Hi95 Hypoxia-induced gene protein protein human Homo sapiens Human MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT DIP protein P58004 original sequence version: 125 9C13371316D84060 szt2-mios-1 3 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 ancillary ancillary prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 20:00:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 20:05:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2A/B/F, Extended Data figure 3 A/B,4 Flag–SZT2 pulled down NPRL3 and NPRL2 as well as MIOS and WDR24, but did not pull down Rag GTPases In the absence of NPRL3 this entire interaction was not seen, and was substantially diminished in the absence of WDR59, WDR24 and MIOS. The SZT2–GATOR interaction was not modulated by amino acids, and the stable SOG complex did not dissociate during washes with 1.5 M sodium chloride. depdc5-mios-1 3 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Figure 2A-2 positive control depdc5-mios-2 2 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 19:54:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 19:44:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2B-3 SESN2 pulled down GATOR2, GATOR1 and SZT2. SESN2 pulled down GATOR2, GATOR1 and SZT2 depdc5-mios-3 2 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2B/D endogenous WDR24 co-immunoprecipitated efficiently with WDR59 and MIOS, but not with NPRL2 or NPRL3 Endogenous WDR24 co-immunoprecipitated efficiently with WDR59 and MIOS, but not with NPRL2 or NPRL3. wdr24-mios-7 2 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 2B-2 NPRL3 pulled down NPRL2, but not WDR59, WDR24 or MIOS NPRL3 pulled down NPRL2, but not WDR59, WDR24 or MIOS. sesn2-mios-3 7 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2C Interaction in absence of Flag-SZT2 transfection, higher molecular weight bands, fractions ~13-20. sesn2-mios-4 7 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 17:14:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 19:37:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2C Interaction seen in Flag-SZT2 transfected cells, higher molecular weight fractions only (13-20). nprl2-nprl3-1 7 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2Ci Interaction seen in non-Flag-SZT2 transfected cells, lower molecular weight bands, fractions ~23-28. wdr24-mios-8 2 21 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2D WDR24 pulled down NPRL3 only in SZT2-containing SEC fractions (13-20). WDR24 pulled down NPRL3 only in SZT2-containing SEC fractions nprl2-nprl3-2 4 21 ancillary ancillary prey prey 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2E The presence of SZT2 was required to bind NPRL2/3. nprl2-nprl3-3 4 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2Ei Interaction in the absence of SZT2. szt2-mios-2 3 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 18:17:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 17:29:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Figure 2F Weak interaction in the absence of WDR59, WDR24 and MIOS. szt2-mios-3 5 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 20:33:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 19:02:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Extended Data Figure 2A nprl2-nprl3-4 7 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed partially purified partially purified infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 20:09:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 16:56:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component partially purified partially purified 9 unspecified role unspecified role neutral component neutral component partially purified partially purified 17 unspecified role unspecified role neutral component neutral component partially purified partially purified 13 unspecified role unspecified role neutral component neutral component partially purified partially purified 16 unspecified role unspecified role neutral component neutral component partially purified partially purified 8 unspecified role unspecified role neutral component neutral component partially purified partially purified 11 unspecified role unspecified role neutral component neutral component partially purified partially purified association association Extended Data Figure 2 F/G Fraction containing (purified) SOG complex the purified SZT2 complex contained both GATOR1 and GATOR2 components nprl2-nprl3-5 6 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Extended Data Figure 2H Interaction seen in Sucrose fractions1-5 inclusive, in both the presence and absence of SZT2. I am not sure if SZT2 is present when it has not been deleted - probably the band/Streak at top of the gel? text = no help. I have assumed it IS meant to be present if not deleted, otherwise no point in the experiment! nprl2-nprl3-6 6 12 unspecified role unspecified role neutral component neutral component cell lysate cell lysate 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Extended Data Figure 2Hi Interaction seen in Sucrose fractions 7-17 inclusive, in the presence of SZT2. lamp1-nprl2-1 6 12 unspecified role unspecified role neutral component neutral component cell lysate cell lysate 21 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Extended Data figure 2Hii Interaction seen in Sucrose fractions 9-17 inclusive, in the absence of SZT2, and also fractions 19-21 in presence and absence of SZT2, except for fraction 21 where Lamp1 is not detected in the presence of SZT2. szt2-nprl2-1 3 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 18:49:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 18:36:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Extended Data 4 szt2-nprl3-1 3 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 19:36:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 18:10:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Extended Data 4-D Deletion of a small portion (amino acids 1,083–1,189) within the GATOR1-binding region (amino acids 935–1,734) created a SZT2 mutant, SZT2(Delta1,083–1,189), that had minimal GATOR1 binding activity, but that had preserved interaction with GATOR2 Deletion of a small portion (amino acids 1,083–1,189) within the GATOR1-binding region (amino acids 935–1,734) created a SZT2 mutant, that had minimal binding to NPRL3. lamp2-szt2-1 1 18 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 19 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 21 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed infection infection fixed cell fixed cell Q5T011:p.Ile1938Thr mutation mutation certain certain sequence position certain certain certain sequence position certain I T Wed May 02 19:57:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1938thr' Tue Jun 30 17:50:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1938Thr' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Extended Data 5C 123456qwerty-1 3 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait engineered engineered region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Extended Data 3E Interaction seen when cells stably over-expressing Flag–WDR24 were deprived of amino acids. The interaction of SESN2 with GATOR2 (WDR24/59/MIOS) was unchanged in the absence of SZT2. interaction of SESN2 with GATOR2 was unchanged in the absence of SZT2 wdr24-mios-9 3 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait engineered engineered region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Extended Data 3E-2 Interaction seen when cells stably over-expressing Flag–WDR24 were re-stimulated with amino acids after prior deprivation. wdr24-mios-10 3 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Extended Data 3F SESN2 overexpression did not affect the interaction between SZT2, GATOR1 and GATOR2. SESN2 overexpression did not affect the interaction between SZT2, GATOR1 and GATOR2 I assume Nprl3 IS present, as this is only member of GATOR1 shown, (despite faint/absent band)