MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it ABL2 suppresses FLT3-ITD-induced cell proliferation through negative regulation of AKT signaling. ABL2 suppresses FLT3-ITD-induced cell proliferation through negative regulation of AKT signaling. Oncotarget 2017 imex curation Kazi JU., Rupar K., Marhäll A., Moharram SA., Khanum F., Shah K., Gazi M., Nagaraj SR., Sun J., Chougule RA., Rönnstrand L. kazi.uddin@med.lu.se,lars.ronnstrand@med.lu.se 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kazi JU., Rupar K., Marhäll A., Moharram SA., Khanum F., Shah K., Gazi M., Nagaraj SR., Sun J., Chougule RA., Rönnstrand L. kazi.uddin@med.lu.se,lars.ronnstrand@med.lu.se kazi.uddin@med.lu.se; lars.ronnstrand@med.lu.se Accepted 2018-SEP-07 AT 15:20 BST AT 15:20 BST by LUANA Oncotarget 2017 Only protein-protein interactions imex curation imex curation avevo in effetti considerato i commenti nel testo senza guardare con attenzione la figura....me tapina...dici di lasciare solo quelli al massimo neri come legnati? ABL2 suppresses FLT3-ITD-induced cell proliferation through negative regulation of AKT signaling. ABL2 suppresses FLT3-ITD-induced cell proliferation through negative regulation of AKT signaling. Oncotarget 2017 imex curation Kazi JU., Rupar K., Marhäll A., Moharram SA., Khanum F., Shah K., Gazi M., Nagaraj SR., Sun J., Chougule RA., Rönnstrand L. kazi.uddin@med.lu.se,lars.ronnstrand@med.lu.se 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein array protein array tag visualisation tag visualisation Kazi JU., Rupar K., Marhäll A., Moharram SA., Khanum F., Shah K., Gazi M., Nagaraj SR., Sun J., Chougule RA., Rönnstrand L. kazi.uddin@med.lu.se,lars.ronnstrand@med.lu.se kazi.uddin@med.lu.se; lars.ronnstrand@med.lu.se Accepted 2018-SEP-07 AT 15:20 BST AT 15:20 BST by LUANA Oncotarget 2017 Only protein-protein interactions imex curation imex curation avevo in effetti considerato i commenti nel testo senza guardare con attenzione la figura....me tapina...dici di lasciare solo quelli al massimo neri come legnati? crkl_human Crk-like protein CRKL protein protein human Homo sapiens Human MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE DIP protein P46109 original sequence version: 64 DIP protein P46109 original sequence version: 103 DIP protein P46109 original sequence version: 104 DIP protein P46109 original sequence version: 156 294CF1EE2CD44B81 abl2_human Tyrosine-protein kinase ABL2 Abelson tyrosine-protein kinase 2 ABL2 ABLL ARG Abelson murine leukemia viral oncogene homolog 2 Abelson-related gene protein Tyrosine-protein kinase ARG protein protein human Homo sapiens Human MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR ED93869BC2B14FAA ED93869BC2B14FAA crk_human Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 4CFBFB65BFC2E265 lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D tens1_human Tensin-1 TNS1 TNS protein protein human Homo sapiens Human MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGMEEVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDEPVPGASSATAALSPQEKRELDRLLSGFGLEREKQGAMYHTQHLRSRPAGGSAVPSSGRHVVPAQVHVNGGALASERETDILDDELPNQDGHSAGSMGTLSSLDGVTNTSEGGYPEALSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQSFSEAEPQLPPAPVRGGSSREAVQRGLNSWQQQQQQQQQPRPPPRQQERAHLESLVASRPSPQPLAETPIPSLPEFPRAASQQEIEQSIETLNMLMLDLEPASAAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYIPSGHSLGTPEPAPRASLESVPPGRSYSPYDYQPCLAGPNQDFHSKSPASSSLPAFLPTTHSPPGPQQPPASLPGLTAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPSSPPPSGVRSPPGLAKTPLSALGLKPHNPADILLHPTGVTRRRIQPEEDEGKVVVRLSEEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYGHEIPLRNGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGPRTPTQPLLESGFRSGSLGQPSPSAQRNYQSSSPLPTVGSSYSSPDYSLQHFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTPPSPGFGWRAINPSMAAPSSPSLSHHQMMGPPGTGFHGSTVSSPQSSAATTPGSPSLCRHPAGVYQVSGLHNKVATTPGSPSLGRHPGAHQGNLASGLHSNAIASPGSPSLGRHLGGSGSVVPGSPCLDRHVAYGGYSTPEDRRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSVGDRAGSLPNYATINGKVSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQKR DIP protein Q9HBL0 original sequence version: 118 90C173D5E371EF3E blk_human Tyrosine-protein kinase Blk BLK B lymphocyte kinase p55-Blk protein protein human Homo sapiens Human MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVLEDFYTATERQYELQP B5F739BEF8389176 ksyk_human Tyrosine-protein kinase SYK SYK Spleen tyrosine kinase p72-Syk protein protein human Homo sapiens Human MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN DIP protein P43405 original sequence version: 146 EAA6BDE65881FC68 fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL DIP protein P06241 original sequence version: 195 DIP protein P06241 original sequence version: 147 DIP protein P06241 original sequence version: 164 4A1E443A4B5A0977 socs6_human Suppressor of cytokine signaling 6 SOCS6 CIS4 SOCS4 Cytokine-inducible SH2 protein 4 Suppressor of cytokine signaling 4 protein protein human Homo sapiens Human MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY AE513312A999B763 flt3_human Receptor-type tyrosine-protein kinase FLT3 FLK2 FL cytokine receptor Fetal liver kinase-2 FLT3 STK1 Fms-like tyrosine kinase 3 Stem cell tyrosine kinase 1 CD135 protein protein human Homo sapiens Human MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS DIP protein P36888 original sequence version: 118 rasa1_human Ras GTPase-activating protein 1 Ras p21 protein activator p120GAP RASA1 RASA GAP protein protein human Homo sapiens Human MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR DIP protein P20936 original sequence version: 136 DIP protein P20936 original sequence version: 182 C35B6567F5BC5370 abl1_human Tyrosine-protein kinase ABL1 Abelson tyrosine-protein kinase 1 ABL1 ABL JTK7 Abelson murine leukemia viral oncogene homolog 1 Proto-oncogene c-Abl p150 protein protein human Homo sapiens Human MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR DIP protein P00519 original sequence version: 114 DIP protein P00519 original sequence version: 137 DIP protein P00519 original sequence version: 161 DIP protein P00519 original sequence version: 220 DIP protein P00519 original sequence version: 219 85FE6C1C0E483EA2 yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL DIP protein P07947 original sequence version: 131 DIP protein P07947 original sequence version: 148 DIP protein P07947 original sequence version: 140 A2B376084686BBCD abl2-flt3-2 2 4 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a In order to identify novel FLT3-interacting proteins we used an SH2 domain array [22]. Seventy-four recombinant SH2 domains from 64 different proteins were used. Three different tyrosine phosphorylated peptides corresponding to residues Y726, Y793 and Y842 in FLT3 were used to determine the binding to the SH2 domains. We observed that the ABL2 SH2 domain displayed the highest affinity to the tyrosine phosphorylated FLT3 peptides (Figure ​(Figure1A).1A). abl2-flt3-1 2 4 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a In order to identify novel FLT3-interacting proteins we used an SH2 domain array [22]. Seventy-four recombinant SH2 domains from 64 different proteins were used. Three different tyrosine phosphorylated peptides corresponding to residues Y726, Y793 and Y842 in FLT3 were used to determine the binding to the SH2 domains. We observed that the ABL2 SH2 domain displayed the highest affinity to the tyrosine phosphorylated FLT3 peptides (Figure ​(Figure1A).1A). crkl-flt3-2 2 3 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling crkl-flt3-3 2 3 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling crk-flt3-2 2 5 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling crk-flt3-3 2 5 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling fyn-flt3-1 2 10 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling fyn-flt3-2 2 10 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling abl1-flt3-1 2 14 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling abl1-flt3-2 2 14 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling lck-flt3-1 2 6 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling lck-flt3-2 2 6 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling socs6-flt3-3 2 11 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr842 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling syk-flt3-7 2 9 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr842 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling abl2-flt3-4 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f1b rasa1-flt3-1 2 13 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr793 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling rasa1-flt3-2 2 13 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling blk-flt3-1 2 8 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr842 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling tns1-flt3-1 2 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phostyr842 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling yes1-flt3-1 2 15 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified SH2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phostyr726 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction f1a The recombinant SH2 domain of ABL2 displayed a high affinity for multiple phosphopeptides corresponding to known FLT3 tyrosine phosphorylation sites. In addition to the ABL2 SH2 domain, the SH2 domains of CRK, CRKL, FYN, ABL, LCK, SOCS6, SYK etc. also displayed a considerable affinity for those phosphopeptides. Many of those proteins have already been verified by biochemical methods and identified as critical regulators of FLT3 signaling