UniProt UniProt http://www.uniprot.org Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Scientific reports 2016 imex curation Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp Accepted 2018-JAN-18 AT 14:24 GMT AT 14:24 GMT by MGT Scientific reports 2016 imex curation Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Scientific reports 2016 imex curation Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp Accepted 2018-JAN-18 AT 14:24 GMT AT 14:24 GMT by MGT Scientific reports 2016 imex curation Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Group A Streptococcus exploits human plasminogen for bacterial translocation across epithelial barrier via tricellular tight junctions. Scientific reports 2016 imex curation Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Sumitomo T., Nakata M., Higashino M., Yamaguchi M., Kawabata S. kawabata@dent.osaka-u.ac.jp Accepted 2018-JAN-18 AT 14:24 GMT AT 14:24 GMT by MGT Scientific reports 2016 imex curation plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 8B31CB877CCB3AB6 mald2_human MARVEL domain-containing protein 2 MARVELD2 TRIC Tricellulin protein protein human Homo sapiens Human MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISALVCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS 04F3FCB2CFDB162B eno_strpm Enolase eno 2-phosphoglycerate dehydratase M28_Spy0535 2-phospho-D-glycerate hydro-lyase protein protein Streptococcus pyogenes serotype M28 (strain MGAS6180) Streptococcus pyogenes serotype M28 (strain MGAS6180) MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETILKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEELVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANSILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK DFEF40246CDD7FA9 marveld2-plg-1 2 4 unspecified role unspecified role prey prey purified purified 5 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ec1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8N4S9:p.Lys217Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:05:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala' Tue Jun 30 17:02:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys217Ala' Q8N4S9:p.Lys252Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:34:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys252ala' Tue Jun 30 18:12:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys252Ala' Q8N4S9:p.[Lys217Ala;Lys252Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Mon Jan 22 16:44:35 GMT 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala,lys2ala52' Wed May 02 19:49:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala,lys252ala' Tue Jun 30 19:57:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys217Ala;Lys252Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 marveld2-plg-2 3 6 unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role ancillary ancillary purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ec1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8N4S9:p.Lys252Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:33:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys252ala' Tue Jun 30 20:14:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys252Ala' Q8N4S9:p.[Lys217Ala;Lys252Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Mon Jan 22 17:18:21 GMT 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala,lys2ala52' Wed May 02 15:36:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala,lys252ala' Tue Jun 30 19:59:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys217Ala;Lys252Ala]' Q8N4S9:p.Lys217Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:07:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys217ala' Tue Jun 30 18:04:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys217Ala' ecoli Escherichia coli (strain K12) physical association physical association Figs. 3, 5C To test the interaction of tricellulin extracellular domains with PLG, we constructed His-tagged tricellulin EC1 and EC2 fragments, and then evaluated their ability to associate with PLG using surface plasmon resonance (SPR) measurement. eno-plg-1 1 6 unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction Fig. 5B To investigate whether species specificity of PLG is related to SEN binding, dot spot overlay analyses using human and bovine PLG were employed.