IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Oncotarget 2015 imex curation Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. aime.vazquez@inserm.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-bl41 human-bl1 burkitt lymphoma Human bl41 BL41 cell line RRID:CVCL_DR95 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. aime.vazquez@inserm.fr Accepted 2018-JUL-10 AT 11:24 BST AT 11:24 BST by PPORRAS Oncotarget 2015 Only protein-protein interactions imex curation imex curation All done; all done Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Oncotarget 2015 imex curation Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. aime.vazquez@inserm.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. cells pre-treated with 10 μM QVD-OPh aime.vazquez@inserm.fr Accepted 2018-JUL-10 AT 11:24 BST AT 11:24 BST by PPORRAS Oncotarget 2015 Only protein-protein interactions imex curation imex curation All done; all done Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells. Oncotarget 2015 imex curation Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. aime.vazquez@inserm.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A., Ambroise G., Portier A., Roders N., Arnoult D., Vazquez A. cells pre-treated with 10 μM QVD-OPh plasmid containing human beta isoform of puma aime.vazquez@inserm.fr Accepted 2018-JUL-10 AT 11:24 BST AT 11:24 BST by PPORRAS Oncotarget 2015 Only protein-protein interactions imex curation imex curation All done; all done bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN DIP protein Q9BXH1 original sequence version: 32 3585527F1858A4FA bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F q9bxh1-2 Bcl-2-binding component 3, isoforms 1/2 PUMA beta BBC3 PUMA JFY-1 p53 up-regulated modulator of apoptosis protein protein human Homo sapiens Human MKFGMGSAQACPCQVPRAASTTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN No experimental confirmation available 674939670238F4AC mcl1-bcl2-puma-1 1 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig 4Ab Anisomycin (CHEBI:338412) treatment was required for the interaction to be visible in BL41 cells. . bbc3-bcl2-3 3 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig 4B bbc3-mcl1-5 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig 4B