IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. Nucleic acids research 2015 imex curation Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. david_willjr@med.unc.edu,gdginder@vcu.edu 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. Fig 2- I was not sure that the IDR was binding DNA, but Discussion states "This region does not adopt a regular structure even when bound to methylated DNA." - so it does bind! 2D 15N-HSQC spectra david_willjr@med.unc.edu,gdginder@vcu.edu Accepted 2018-APR-24 AT 19:21 BST AT 19:21 BST by ORCHARD Nucleic acids research 2015 Only protein-protein interactions imex curation imex curation I have removed all Variable Experimental conditions and added salt concentration as a comment. I had added the Expt. Condits as the Kds differ under different salt concentrations. Two new interactions added for MBD2FLsc + two salt concentrations.; I have removed IDR as a Sufficient to Bind region, and added 13C label. I dont understand what you want me to do with the "purple blobs" - this is the p66a (GATAD2A) - = the MBD2FLsc construct (MBD2 aas 150-393 + 42 aas of p66) which is also used for SPR and FPS (where it gives a lower Kd value) - so if I add it here, it should be added elsewhere. ********* I have added a new interaction for fig 2 - for in effect the MBD2FLsc and MBD2-p66α cc - purple blob complex. I have add for SPR the interaction with MBD2FLsc construct. Supp fig 1C does not have any DNA present - so no interaction shown. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. Nucleic acids research 2015 imex curation Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. david_willjr@med.unc.edu,gdginder@vcu.edu 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. david_willjr@med.unc.edu,gdginder@vcu.edu Accepted 2018-APR-24 AT 19:21 BST AT 19:21 BST by ORCHARD Nucleic acids research 2015 Only protein-protein interactions imex curation imex curation I have removed all Variable Experimental conditions and added salt concentration as a comment. I had added the Expt. Condits as the Kds differ under different salt concentrations. Two new interactions added for MBD2FLsc + two salt concentrations.; I have removed IDR as a Sufficient to Bind region, and added 13C label. I dont understand what you want me to do with the "purple blobs" - this is the p66a (GATAD2A) - = the MBD2FLsc construct (MBD2 aas 150-393 + 42 aas of p66) which is also used for SPR and FPS (where it gives a lower Kd value) - so if I add it here, it should be added elsewhere. ********* I have added a new interaction for fig 2 - for in effect the MBD2FLsc and MBD2-p66α cc - purple blob complex. I have add for SPR the interaction with MBD2FLsc construct. Supp fig 1C does not have any DNA present - so no interaction shown. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. Nucleic acids research 2015 imex curation Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. david_willjr@med.unc.edu,gdginder@vcu.edu 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. Immunoprecipitation protocol for full length MBD2Flag constructs was modified to eliminate contamination through non-specific DNA binding. david_willjr@med.unc.edu,gdginder@vcu.edu Accepted 2018-APR-24 AT 19:21 BST AT 19:21 BST by ORCHARD Nucleic acids research 2015 Only protein-protein interactions imex curation imex curation I have removed all Variable Experimental conditions and added salt concentration as a comment. I had added the Expt. Condits as the Kds differ under different salt concentrations. Two new interactions added for MBD2FLsc + two salt concentrations.; I have removed IDR as a Sufficient to Bind region, and added 13C label. I dont understand what you want me to do with the "purple blobs" - this is the p66a (GATAD2A) - = the MBD2FLsc construct (MBD2 aas 150-393 + 42 aas of p66) which is also used for SPR and FPS (where it gives a lower Kd value) - so if I add it here, it should be added elsewhere. ********* I have added a new interaction for fig 2 - for in effect the MBD2FLsc and MBD2-p66α cc - purple blob complex. I have add for SPR the interaction with MBD2FLsc construct. Supp fig 1C does not have any DNA present - so no interaction shown. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex. Nucleic acids research 2015 imex curation Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. david_willjr@med.unc.edu,gdginder@vcu.edu 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Desai MA., Webb HD., Sinanan LM., Scarsdale JN., Walavalkar NM., Ginder GD., Williams DC. Sequence of the 3' FAM labeled reverse strand oligo found from Ref. 10. david_willjr@med.unc.edu,gdginder@vcu.edu Accepted 2018-APR-24 AT 19:21 BST AT 19:21 BST by ORCHARD Nucleic acids research 2015 Only protein-protein interactions imex curation imex curation I have removed all Variable Experimental conditions and added salt concentration as a comment. I had added the Expt. Condits as the Kds differ under different salt concentrations. Two new interactions added for MBD2FLsc + two salt concentrations.; I have removed IDR as a Sufficient to Bind region, and added 13C label. I dont understand what you want me to do with the "purple blobs" - this is the p66a (GATAD2A) - = the MBD2FLsc construct (MBD2 aas 150-393 + 42 aas of p66) which is also used for SPR and FPS (where it gives a lower Kd value) - so if I add it here, it should be added elsewhere. ********* I have added a new interaction for fig 2 - for in effect the MBD2FLsc and MBD2-p66α cc - purple blob complex. I have add for SPR the interaction with MBD2FLsc construct. Supp fig 1C does not have any DNA present - so no interaction shown. mbd2_human Methyl-CpG-binding domain protein 2 MBD2 Methyl-CpG-binding protein MBD2 Demethylase protein protein human Homo sapiens Human MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA FC4E5E0CF9BA0FFA mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED DIP protein O94776 original sequence version: 128 DIP protein O94776 original sequence version: 122 DIP protein O94776 original sequence version: 85 DIP protein O94776 original sequence version: 120 DIP protein O94776 original sequence version: 130 DIP protein O94776 original sequence version: 146 65087AF798BA64EC p66a_human Transcriptional repressor p66-alpha GATA zinc finger domain-containing protein 2A GATAD2A protein protein human Homo sapiens Human MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGLLRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNTSLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQCKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK DIP protein Q86YP4 original sequence version: 114 64F0066B4BEFCB39 rbbp4_human Histone-binding protein RBBP4 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 RBBP4 RBAP48 protein protein human Homo sapiens Human MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q09028 original sequence version: 151 DIP protein Q09028 original sequence version: 111 DIP protein Q09028 original sequence version: 116 DIP protein Q09028-1 original sequence version: 130 DIP protein Q09028 original sequence version: 149 DIP protein Q09028 original sequence version: 159 DIP protein Q09028 original sequence version: 131 B71E2D55A444C360 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA reverse_oligo dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CTCCGCGAGCCGCCGTC 17bp_oligo dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GAGGCGCTCGGCGGCAG 17bp_oligo-mbd2-1 1 11 unspecified role unspecified role neutral component neutral component 5meC9 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified MBD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2 B/C I think they use the Human, rather than Mouse IDR, as the Human one is specifically mentioned in the Methods. ("1H/15N heteronuclear steady-state NOE spectra for human MBD2IDR were collected") 123345qwerty-1 2 5 unspecified role unspecified role prey prey purified purified MBD-+20_IDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain 5meC9 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 3A 12346qwerertyuy-1 2 5 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range MBD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain 5meC9 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3A-2 Binding to unmethylated DNA was with much lower affinity. 1234547uqwtesrujk-1 4 5 unspecified role unspecified role neutral component neutral component purified purified MBD-+20_IDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 3C 50uM NaCl mbd2-reverse_oligo-1 4 5 unspecified role unspecified role neutral component neutral component purified purified MBD-+20_IDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 3C-2 150uM NaCl mbd2-reverse_oligo-2 4 5 unspecified role unspecified role neutral component neutral component purified purified MBD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 3C-3 50uM NaCl mbd2-reverse_oligo-3 4 5 unspecified role unspecified role neutral component neutral component purified purified MBD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 3C-4 150uM NaCl 123446qwettrut-1 3 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9UBB5:p.Leu287Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:52:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu287ala' Tue Jun 30 18:34:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu287Ala' Q9UBB5:p.Arg286_Leu287delinsGluAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RL EA Wed May 02 15:32:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_leu286-287glu_ala' Tue Jun 30 17:07:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg286_Leu287delinsGluAla' Q9UBB5:p.Arg286Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R E Wed May 02 20:17:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg286glu' Tue Jun 30 18:24:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg286Glu' IDR_regions_1+2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4/5. Immunoprecipitation of the NuRD complex by the mutant full length MBD2 revealed impaired interaction with the histone deacetylase core components: RbAp48, HDAC2 and MTA2, with the effect being most pronounced for MTA2. immunoprecipitation of the NuRD complex by the mutant full length MBD2 revealed impaired interaction with the histone deacetylase core components: RbAp48, HDAC2 and MTA2, with the effect being most pronounced for MTA2 The MBD2_IDR of MBD2 strongly interacts, either directly or indirectly, with the RbAp48, HDAC2 and MTA2 components of NuRD while the scMBD2-p66a does not. gatad2a-mbd2-2 1 7 unspecified role unspecified role neutral component neutral component purified purified region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 82 85 direct interaction direct interaction Figure 2 17bp_oligo-gatad2a-2 2 7 unspecified role unspecified role neutral component neutral component purified purified CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain 5meC9 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified fl_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 97 92 direct interaction direct interaction Figure 3A 17bp_oligo-gatad2a-1 4 7 unspecified role unspecified role neutral component neutral component purified purified CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified fl_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 107 102 direct interaction direct interaction Figure 3Ci 50mM NaCl gatad2a-mbd2-1 4 7 unspecified role unspecified role neutral component neutral component purified purified CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component 3_prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 5meC10 dna chemical modification DNA chemical modification DNA epigenetic modification DNA chemical modification dna chemical modification certain certain sequence position certain certain certain sequence position certain C MeC chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified fl_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 112 117 direct interaction direct interaction Figure 3Cii 150mM NaCl