UniProt UniProt http://www.uniprot.org Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Journal of cell science 2014 imex curation Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de Accepted 2018-MAY-15 AT 09:16 BST AT 09:16 BST by LIVIAP Journal of cell science 2014 imex curation Corrected as you suggested. Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Journal of cell science 2014 imex curation Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de Accepted 2018-MAY-15 AT 09:16 BST AT 09:16 BST by LIVIAP Journal of cell science 2014 imex curation Corrected as you suggested. Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Stepwise and cooperative assembly of a cytokinetic core complex in Saccharomyces cerevisiae. Journal of cell science 2014 imex curation Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tian C., Wu Y., Johnsson N. nils.johnsson@uni-ulm.de <nils.johnsson@uni-ulm.de Accepted 2018-MAY-15 AT 09:16 BST AT 09:16 BST by LIVIAP Journal of cell science 2014 imex curation Corrected as you suggested. iqg1_yeast Ras GTPase-activating-like protein IQG1 IQG1 CYK1 IQGAP-related protein 1 Cytokinesis protein 1 YPL242C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAYSGSPSKPGNNNSYLNRYVENLGTNVTPPLRPQSSSKINSSLNIASPSHLKTKTSASNSSATILSKKVESSVSKLKPSLPNKLVGKYTVDLSNYSKIELRYYEFLCRVSEVKIWIEAVIEEALPSEIELCVGDSLRNGVFLAKLTQRINPDLTTVIFPAGDKLQFKHTQNINAFFGLVEHVGVPDSFRFELQDLYNKKNIPQVFETLHILISMINKKWPGKTPALTNVSGQISFTKEEIAACKKAWPRIRDFKSLGTNINTAPASPEEPKEKRSGLIKDFNKFERPNIPVEEILITPRKNITDANCSDFSNTPSPYNEAPKMSNLDVVVEKRKFTPIEPSLLGPTPSLEYSPIKNKSLSYYSPTISKYLTYDTEFYTRRSRAREEDLNYYQTFKYSPSHYSPMRRERMTEEQFLEKVVQLQNICRGVNTRFNLYIQKRLLNLFEQDILRFQACLRGNKFRVLSSMYLPIRRAKIDVPHVEAIQSRIKGSRIRYKYDKLKFTLSRFSCTVELLQAYCRSKLLKTTVNTKLNDIEISHYPLTKLQSYMRASYVRKKVMSLNTKLNDERESIMKFSAIIRGNVVRCSEDAILSAVHDVHKENISKLQSLIRGIFTRSCLASIIYSLGKENCNIIQLSACIRGNAVRHKVQSLFAPENNLSETVHDLQGLVRGILVRYTLDLVDDIVEYNNLALFQAFSRGALVRESLDQKSSFYKRNVRSVIMIQSWIRKSLQRSAYLELLDCPNPSLWAVKKFVHLLNGTATIEEVQNQLESCQASLDSENMKKERLLKSIRQQLNINGVLDKFGLLKDKDHELGISDSTIPKSKYQKYEKLFYMLQVDPSYWKLLYLKEPEFVAKNVYMTFGTVNQRMNDRERSYFTRFVCEMLQNAINEAPSIESFLDNRSQFWQTILQDFLRRESPEFFSIIVPVLDYLSDPVVDFESDPYKIYQEIHGFSSPQHCSPVDDASTKNKFIDNLRCLWHAIEMVAEIYTRKVHTIPVEIRYLCTKIFCYAADKNIEEIDSLRAISSILVNVFVSEYLVNREYYGYKDSNVQKNNQKIDILMKSLATVFEIKNFDGFLDPLNQYANEIKPHIKDVLYNVLVDPEYEQEGDRLIYLDMVSPSPKLELLTEKVLEISGKFEEYLNEFPEADILHDILEKNLDNSSFPRSGRVTLELDASAYRFLVSDDKMRKIYDQVKRAFVYMMQIEDVDTNLYDLSISTILPQDEPNFANFLEQNPKIRDDPMIQKLKPLKYFTLKNVTLKKIHELESTGTFCSSDNKLQNFLNDIANTIKNPNYAIDYVTQEIYITKETLTKISEMNHSLDIELSRLKKHVDHTIKDFQKAKDFSPVHKSKFGNFKNAVKKVQGRERSELQGMKFKWNTKQLYERGVLKTIRGEKLAELTVKVFGSSGPKFPDIIFKISTSDGSRFGIQMIDKRKGPDKRYSDDVDSFSFKDLIKTQVEPKIETWKLFHSNVVVNNSQLLHLIVSFFYKRNAL C0C7582808154DCC cyk2_yeast Cytokinesis protein 2 HOF1 CYK2 YMR032W YM9973.05 Homolog of CDC15 protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYSYEACFWDPNDNGVNILLGHISQGIRSCDSMILFFKQRSELEKDYARRLGAITGKLDKDIGTNMDYGKLNETFNVVLSVEKARAQSHSKQSEILFRQIYTDTKAFAANLQARYTTLSGKIERLRMDKFNKKKGCEVLQKKLQDAQIRFRDLQLNENNMIGAKRVEHNKRELLKWESNSQEYKVQLDVLKQEYKASQKFWIHEWAQLSCELQEMENARISFLQSKLQQFATSSMETYILEQTKMDMLTNHLNSFTAADEISTFSKENGTGRLKHKTSKGDMNSSANWAQMSSISTTSKKTESYMDNIRKLSSQLKETENKRKLASIDKYEKPLPSPEVTMATQFRNSTPVIRNETKVVANPTLSLRSSPVQLQSNVDDSVLRQKPDKPRPIVGEEQLKPDEDSKNPDEKGLMVHKRNQSLSSPSESSSSNPTDFSHIKKRQSMESMTTSVSSMANSIDDSQRFAKSWNSSNRKRKSMSHLQVPSSASSRSDDGGRTPNSAHNLNEDDYNTRRDTSTSTILFKPPVAVRGTSRGHTHRQSMIMQDSSNPIEDALYEMERIQSSSKPGTKTGNIMDERGVVRDRGITVTLPIVTSEGFPVIEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNFIQLLHQGL AE4A76C2F4043021 AE4A76C2F4043021 mlc1_yeast Myosin light chain 1 G3080 MLC1 YGL106W Myosin-2 light chain Calmodulin-like myosin light chain MLC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ D7508123C101E4A6 D7508123C101E4A6 iqg1-mlc1-2 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A, 1B iqg1-hof1-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q12280:p.Gln667Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 17:15:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln667Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q12280:p.Gln695Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 15:53:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln695Ser' Q12280:p.[Gln667Ser;Gln695Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 16:10:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln667Ser;Gln695Ser]' Q12280:p.Gln725Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 17:38:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln725Ser' physical association physical association Fig. 1A, 1B, 3A, 3D A split-ubiquitin analysis defined the stretch between residue 283 and 592 as binding region of Hof1p for Iqg1p (Fig. 1B). iqg1-mlc1-3 3 6 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal snap tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2A iqg1-hof1-3 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role ancillary ancillary purified purified Q12280:p.[Gln667Ser;Gln695Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 20:23:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln667Ser;Gln695Ser]' Q12280:p.Gln667Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 19:22:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln667Ser' Q12280:p.Gln695Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 17:30:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln695Ser' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal snap tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Fig. 2B, 3B iqg1-mlc1-4 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role ancillary ancillary purified purified n-terminal snap tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig. 2C hof1-iqg1-1 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell msos tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q12280:p.[Gln667Ser;Gln695Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q S certain certain sequence position certain certain certain sequence position certain Q S Tue Jun 30 16:19:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln667Ser;Gln695Ser]' colocalization colocalization Fig. 3C