UniProt UniProt http://www.uniprot.org Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy 2014 imex curation Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr 09-May-2019: Contacted by IntAct-Help. liviap Only protein-protein interactions imex curation mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E., Nicot AS., Lo Verso F., Ratti F., Pilot-Storck F., Streichenberger N., Sandri M., Schaeffer L., Goillot E. Alzheimers - Interactions investigated in the context of Alzheimers disease anne-sophie.nicot@ens-lyon.fr,evelyne.goillot@ens-lyon.fr Accepted 2018-NOV-22 AT 11:26 GMT AT 11:26 GMT by LIVIAP Autophagy 2014 liviap Only protein-protein interactions imex curation imex curation Merging EBI-20764425 and EBI-20764369 - I disagree as the inhibitor was only added to the wt protein I have separated out mutated GSKvs wt substrate from wt GSK vs mutated substrate - I assume that is what you meant. gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 nbr1_human Next to BRCA1 gene 1 protein Neighbor of BRCA1 gene 1 protein Membrane component chromosome 17 surface marker 2 Protein 1A1-3B NBR1 1A13B KIAA0049 M17S2 Cell migration-inducing gene 19 protein MIG19 protein protein human Homo sapiens Human MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY 6A057E67947838EF 1-azakenpaullone 1-azakenpaullone 1-AKP 9-bromo-7,12-dihydropyrido[3',2':2,3]azepino[4,5-b]indol-6(5H)-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gsk3a_human Glycogen synthase kinase-3 alpha GSK3A Serine/threonine-protein kinase GSK3A protein protein human Homo sapiens Human MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS F18C012C03B7D786 ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV B6E7BC06FEE77196 sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD nbr1_mouse Next to BRCA1 gene 1 protein Neighbor of BRCA1 gene 1 protein Membrane component chromosome 17 surface marker 2 homolog Nbr1 M17s2 protein protein mouse Mus musculus Mouse MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALPKNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDWFTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFSWHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFFYSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQEEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVSAKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTEGQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPERESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPATMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHNGSSIAGGLVKGALSVAASAYKALFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNNDWYSHRY E5BB4B281FE33CE0 mlp3b_mouse Microtubule-associated proteins 1A/1B light chain 3B Map1lc3b Map1alc3 Map1lc3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein mouse Mus musculus Mouse MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV DIP protein Q9CQV6 original sequence version: 118 DIP protein Q9CQV6 original sequence version: 123 mint Probably involved in formation of autophagosomal vacuoles (autophagosomes) 520E29028163FA8D gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F sqstm_mouse Sequestosome-1 Ubiquitin-binding protein p62 STONE14 Sqstm1 A170 STAP protein protein mouse Mus musculus Mouse MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDGAGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q64337 original sequence version: 121 DIP protein Q64337 original sequence version: 130 ED4CCCA7741D35CA gsk3a-nbr1-3 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49840:p.Lys148Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:26:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' P49840:p.Ser21Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 15:49:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser21Ala' physical association physical association Supp. Fig. 1A gsk3b-nbr1-2 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49841:p.Lys85Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:22:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys85Ala' P49841:p.Ser9Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:44:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser9Ala' physical association physical association Supp. Fig. 1A gsk3a-nbr1-4 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 enzyme enzyme unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49840:p.Lys148Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:00:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' P49840:p.Ser21Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 15:56:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser21Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Fig. 1B, Supp. Fig. 1B gsk3b-nbr1-3 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 enzyme enzyme unspecified role unspecified role purified purified P49841:p.Arg96Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 18:46:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg96Ala' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49841:p.Lys85Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:09:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys85Ala' P49841:p.Ser9Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser9Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Fig. 1B, 1C, Supp Fig. 1D 1_azakenpaullone-gsk3a-1 1 9 inhibitor inhibitor unspecified role unspecified role 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 enzyme enzyme unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Supp. Fig. 1B gsk3a-1 1 10 putative self putative self putative self putative self purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49840:p.Lys148Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:38:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' P49840:p.Ser21Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 15:51:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser21Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation true Fig. 1B sqstm1-nbr1-6 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr586Ala;Ser590Ala] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:26:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 19:08:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 12 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp. Fig. 3A ubc-nbr1-1 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:15:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 19:52:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp. Fig. 3A map1lc3b-nbr1-8 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:09:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 18:21:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp. Fig. 3A gabarap-nbr1-4 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:51:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 18:34:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 15 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp. Fig. 3A nbr1-map1lc3b-1 5 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:08:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 16:10:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supp. Fig. 3B nbr1-sqstm1-3 4 17 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Supp. Fig. 2A, 2B nbr1-sqstm1-4 6 17 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunohistochemistry immunohistochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:04:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 18:42:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' colocalization colocalization Supp. Fig. 4A map1lc3b-nbr1-11 6 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunohistochemistry immunohistochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:47:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14596:p.[Thr586Glu;Ser590Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 18:50:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Glu;Ser590Glu]' colocalization colocalization Supp. Fig. 4B gsk3a-nbr1-5 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.Thr581Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 19:00:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr581Ala' Q14596:p.Thr586Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 16:06:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr586Ala' Q14596:p.Ser590Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:37:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser590Ala' Q14596:p.[Thr586Ala;Ser590Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:57:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr586Ala;Ser590Ala]' Q14596:p.[Thr581Ala;Thr586Ala;Ser590Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed Sep 26 13:02:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr581Ala:Thr586Ala;Ser590Ala]' Tue Jun 30 17:02:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr581Ala;Thr586Ala;Ser590Ala]' 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49840:p.Lys148Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:34:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' P49840:p.Ser21Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:29:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser21Ala' physical association physical association Supp. Fig. 1C gsk3b-16 1 7 putative self putative self putative self putative self purified purified P49841:p.Arg96Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 16:30:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg96Ala' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49841:p.Lys85Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:34:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys85Ala' P49841:p.Ser9Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 15:35:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser9Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation true Fig. 1B gsk3b-nbr1-4 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified Q14596:p.Thr581Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 15:57:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr581Ala' Q14596:p.Thr586Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 19:28:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr586Ala' Q14596:p.Ser590Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:57:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser590Ala' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14596:p.[Thr581Ala;Thr586Ala;Ser590Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Tue Mar 19 11:10:47 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr581Ala:Thr586Ala;Ser590Ala]' Tue Jun 30 17:19:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr581Ala;Thr586Ala;Ser590Ala]' 7 enzyme enzyme unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P49841:p.Ser9Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:52:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser9Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Fig. 1C