UniProt UniProt http://www.uniprot.org Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins. Nucleic acids research 2013 imex curation von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E., von Moeller H., Lerner R., Ricciardi A., Basquin C., Marzluff WF., Conti E. conti@biochem.mpg.de Accepted 2018-DEC-05 AT 14:11 GMT AT 14:11 GMT by PPORRAS Nucleic acids research 2013 imex curation eri1_human 3'-5' exoribonuclease 1 ERI1 3'EXO THEX1 3'-5' exonuclease ERI1 Eri-1 homolog Histone mRNA 3'-end-specific exoribonuclease Histone mRNA 3'-exonuclease 1 Protein 3'hExo protein protein human Homo sapiens Human MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK DIP protein Q8IV48 original sequence version: 129 D5837AA05F09410C slbp_human Histone RNA hairpin-binding protein SLBP HBP Histone stem-loop-binding protein protein protein human Homo sapiens Human MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS DIP protein Q14493 original sequence version: 119 DIP protein Q14493-1 original sequence version: 139 4E84E502393D1BF7 m4gdb_danre MIF4G domain-containing protein B mif4gdb zgc:110826 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MENSSKEDYKIQSFDLETQKLLKTALKDPGSVDLEKVSSVIVDQSLKDQVFSREAGRICYTIVQAEAKQTNGSVFRRNLLNRLQQEFKAREETRKRSTQEWVCLVSFICNIFDYLKVNNMPMVALVHPVYDCLFRLAQSDALKNEEEVDCLVLQLHRIGDQLEKMNVQLMDELFNLLRDGFLLQEDLSSMGRLLLLEILEFRAGGWKLSDTAQKYYYSEVTD 26059435E7469867 dd19b_human ATP-dependent RNA helicase DDX19B DEAD box protein 19B DEAD box RNA helicase DEAD5 DDX19B DBP5 DDX19 TDBP protein protein human Homo sapiens Human MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN 8F6F93B12B7E9871 mi4gd_human MIF4G domain-containing protein SLIP1 SLBP-interacting protein 1 MIF4GD protein protein human Homo sapiens Human MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD 07E5B651D638AC9D q7zu28_danre RNA helicase ddx19 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATDSWAQAVDEQEAAAESISTLQISEKEEKPTAEANGAKTEAKTEAKTEANADKTEEDDKDDKAAQSLLNKLIRSNLVNTTNQVEVLQRDPSSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQETALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSHVDPENKWPQCLCVSPTYELALQTGKVIEQMGKHYPEVQLVYAIRGNKLERGTKLQEQIVIGTPGTVLDWCQKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPKTCQMLLFSATFEETVWNFAKRIVPDPNIIKLKREEETLDTIKQYYVICNSKEEKFQALCNIYGAITIAQAMIFCHTRKTAGWLAGELSREGHQVALLSGEMQVEQRAAVIERFRDGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAINMVDSKFSMNILNRIQDHFNKKIEKLDTDDLDEIEKIAN 3C2AE8A2C2DC7F75 q7sxi8_danre slbp sb:cb157 si:dkey-102m7.2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish IQTRQLIVRAGSILHPLEAMSEQQKYKYENDYKSSEDRNKGASRWSQCRKRGADGILRKSHADEEPDKDRRCSKRSESFTTPESEGPVSRIKNWGDEVEEQEMRTNVRRDFHRYRRRILASDFPQRDRKISSGSSDSRDSRDSKESPAKGDIETDETTLIRRQKQINYGKNTLAYDRYIKEVPKHLRQPGVHPKTPNKFKKYSRRSWDQQIKLWRVKLHAWDPPAEEGGDLQQIEEIDLGEIMDFELDVEMTENTESQCSSSNGAAQSLQEDAFMETPKKMMKIEDSDMS 1A55E994933AA798 myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 eif3g_human Eukaryotic translation initiation factor 3 subunit G EIF3G EIF3S4 Eukaryotic translation initiation factor 3 subunit 4 eIF-3-delta Eukaryotic translation initiation factor 3 RNA-binding subunit eIF3 p44 eIF3 p42 protein protein human Homo sapiens Human MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN DIP protein O75821 original sequence version: 87 7D7226FEDE9D6FBB ddx19-mif4gdb-1 2 15 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 3.25A R working 0.244 R free 0.277 mif4gdb-slbp-1 2 16 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 2.51A R working 0.192 R free 0.243 mif4gd-ddx19b-1 1 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 3A mif4gd-eif3g-1 1 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 3A mif4gd-myc-1 1 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 3A mif4gd-eri1-1 1 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 3A mif4gd-mif4gd-1 1 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 3A mif4gd-myc-2 8 17 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B mif4gd-ddx19b-2 8 13 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-20740397]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 0-0, sequence length 479 [EBI-20740397]0-0 in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B mif4gd-eif3g-2 8 18 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B mif4gd-eri1-2 8 10 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B mif4gd-mif4gd-2 8 14 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B mif4gd-slbp-9 8 11 unspecified role unspecified role prey prey cell lysate cell lysate region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-20740426]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 439-439, sequence length 270 [EBI-20740426]255-439 in vitro In vitro 14 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A9UHW6:p.[Arg77Ala;Asn81Ala;Gln84Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 20:25:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg77Ala;Asn81Ala;Gln84Ala]' ecoli Escherichia coli (strain K12) physical association physical association Fig. 2D, 3B ddx19b-mif4gd-5 7 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4A Confirmed with an anti-MIF4GD western We tested the interaction of HA-tagged-DBP5 with endogenous SLIP1 after immunoprecipitation with anti-SLIP1 (Figure 4A, top panel) ddx19b-mif4gd-6 4 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4B To assess whether the endogenous SLIP1 and DBP5 interacted, we immunoprecipitated using the anti-SLIP1 antibody, and analyzed the immunoprecipitates for DBP5 by western blotting with an anti-DBP5 antibody. ddx19b-mif4gd-7 3 14 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4C ddx19-mif4gdb-2 3 15 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4C ddx19b-mif4gd-8 6 14 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4D, Supp. Fig. 1A mif4gd-10 9 14 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 2 mif4gd-ddx19b-3 5 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4A Confirmed with an anti-MIF4GD western