IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Sestrin2 modulates AMPK subunit expression and its response to ionizing radiation in breast cancer cells. Sestrin2 modulates AMPK subunit expression and its response to ionizing radiation in breast cancer cells. PloS one 2011 imex curation Sanli T., Linher-Melville K., Tsakiridis T., Singh G., Sanli T., Linher-Melville K., Tsakiridis T., Singh G. Results from Figure 2 (Immunofluorescence Microscopy) have not been included due to lack of antibody specificity. probably a waste of time to curate this as no interactions for SESN1- but had spent some time on it already so thought I would finish it off. gurmit.singh@jcc.hhsc.ca 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sanli T., Linher-Melville K., Tsakiridis T., Singh G., Sanli T., Linher-Melville K., Tsakiridis T., Singh G. Results from Figure 2 (Immunofluorescence Microscopy) have not been included due to lack of antibody specificity. probably a waste of time to curate this as no interactions for SESN1- but had spent some time on it already so thought I would finish it off. gurmit.singh@jcc.hhsc.ca Accepted 2018-FEB-14 AT 14:53 GMT AT 14:53 GMT by LUANA PloS one 2011 Only protein-protein interactions imex curation imex curation aapk1_human 5'-AMP-activated protein kinase catalytic subunit alpha-1 PRKAA1 AMPK1 Tau-protein kinase PRKAA1 Acetyl-CoA carboxylase kinase Hydroxymethylglutaryl-CoA reductase kinase protein protein human Homo sapiens Human MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ DIP protein Q13131 original sequence version: 149 DIP protein Q13131 original sequence version: 91 DIP protein Q13131 original sequence version: 165 DIP protein Q13131 original sequence version: 164 ABAE71FBF912947A aakg1_human 5'-AMP-activated protein kinase subunit gamma-1 PRKAG1 protein protein human Homo sapiens Human METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP DIP protein P54619 original sequence version: 136 DIP protein P54619 original sequence version: 138 0F22B9CA1DBD87AE aakb1_human 5'-AMP-activated protein kinase subunit beta-1 PRKAB1 AMPK protein protein human Homo sapiens Human MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI DIP protein Q9Y478 original sequence version: 145 F0BCAA94D5BC15FC aakb2_human 5'-AMP-activated protein kinase subunit beta-2 PRKAB2 protein protein human Homo sapiens Human MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI DIP protein O43741 original sequence version: 121 DIP protein O43741 original sequence version: 98 DIP protein O43741 original sequence version: 112 42B23BD70B92519C prkaa1-prkab1-12 1 2 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 1A I have added in the experimental preparation of the 3 participants: living cell prkaa1-prkab1-13 1 2 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 1A-2 I added in the experimental preparation for all the participants: living cells prkab1-prkaa1-1 1 5 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 2 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 1A-3 this interaction is not mentioned in the text, but alpha-1 band is stronger than most. I added in the experimental preparation for all the participants: living cells prkab1-prkaa1-2 1 2 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 1A-4 I added in the experimental preparation for all the participants: living cells