UniProt UniProt http://www.uniprot.org Three-stage assembly of the cysteine synthase complex from Escherichia coli. Three-stage assembly of the cysteine synthase complex from Escherichia coli. The Journal of biological chemistry 2012 imex curation Wang T., Leyh TS. tom.leyh@einstein.yu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Wang T., Leyh TS. tom.leyh@einstein.yu.edu Accepted 2018-SEP-10 AT 15:58 BST AT 15:58 BST by LIVIAP The Journal of biological chemistry 2012 imex curation o-acetyl-l-serine O-acetyl-L-serine L-Serine, acetate (ester) O-acetyl-L-serine O-Acetyl-L-serine O3-acetyl-L-serine O3-Acetyl-L-serine O-acetyl-L-serine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pyridoxal 5'-phosphate(2-) pyridoxal 5'-phosphate(2-) 3-hydroxy-5-(hydroxymethyl)-2-methylisonicotinaldehyde 5-phosphate dianion 3-hydroxy-5-(hydroxymethyl)-2-methylisonicotinaldehyde 5-phosphate(2-) pyridoxal 5'-phosphate pyridoxal 5'-phosphate dianion (4-formyl-5-hydroxy-6-methylpyridin-3-yl)methyl phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) NGVDGCNFYWLIFO-UHFFFAOYSA-L NGVDGCNFYWLIFO-UHFFFAOYSA-L cysk_ecoli Cysteine synthase A O-acetylserine sulfhydrylase A O-acetylserine (thiol)-lyase A Sulfate starvation-induced protein 5 cysK cysZ b2414 JW2407 S-carboxymethylcysteine synthase protein protein ecoli Escherichia coli (strain K12) MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ 20ADDE911845AE72 20ADDE911845AE72 cyse_ecoli Serine acetyltransferase cysE b3607 JW3582 protein protein ecoli Escherichia coli (strain K12) MSCEELEIVWNNIKAEARTLADCEPMLASFYHATLLKHENLGSALSYMLANKLSSPIMPAIAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPDSDKPSMDMDQHFNGINHTFEYGDGI 466EB898750EF709 cyse-cysk-1 1 3 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 8 direct interaction direct interaction Fig. 1A, 2C, 3A, 6 cysk-pyridoxal 5'_phosphate(2_)-1 1 3 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 18 22 20 direct interaction direct interaction Fig. 1A, 2C cyse-cysk-2 1 3 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1A, 2C, 5 cyse-cysk-3 1 2 allosteric effector allosteric effector unspecified role unspecified role 3 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A, 2B, 3 The complex dissociates at OAS concentrations in excess of 50 um