IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. The Journal of biological chemistry 2011 imex curation Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. 1]I cannot add SIE probe(whatever that is-possibly the SIS-inducible element of the c-fos gene ?) as No sequence given. 2]The only "cold" probe I can see is for OSM +4 hrs. 3] Figure 7D (regarding the Caution):- the U373 (mg) cell line is a "glioblastoma astrocytoma " and presumably not to be confused with "Human cortical astrocyte culture" which IS used in Supp. fig 4. Cells used were transfected with NFI-X3-FLAG. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu Accepted 2018-JUN-26 AT 13:26 BST AT 13:26 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation added stat3 interaction (Fig s4) and GO term A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. The Journal of biological chemistry 2011 imex curation Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u373 Homo sapiens u373 u373 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. Cells were transfected with either Flag-NFI-X3 or Flag-NFI-X1. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu Accepted 2018-JUN-26 AT 13:26 BST AT 13:26 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation added stat3 interaction (Fig s4) and GO term A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. The Journal of biological chemistry 2011 imex curation Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u373 Homo sapiens u373 u373 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. Interactions involving anti-H3 antibodies have not been annotated due to antibody non-specificity. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu Accepted 2018-JUN-26 AT 13:26 BST AT 13:26 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation added stat3 interaction (Fig s4) and GO term A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. The Journal of biological chemistry 2011 imex curation Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. Cells were transfected with either Flag-NFI-X3 or Flag-NFI-X1 as well as STAT3-V5. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu Accepted 2018-JUN-26 AT 13:26 BST AT 13:26 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation added stat3 interaction (Fig s4) and GO term A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40. The Journal of biological chemistry 2011 imex curation Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u373 Homo sapiens u373 u373 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T., Singh SK., Bhardwaj R., Wilczynska KM., Dumur CI., Kordula T. the antibody used for IP is not specific;however I have entered these interactions as they must be occurring. Cells were transfected with either NFI-X3 or NFI-X1. NFI-X1 has been entered as the Q14938-3, a protein of 441aas as taken from figure 2 sequence, Ref.14. NFI-X3 has been entered as isoform 4 (Q14938-4) from ref.14.(GenBank Identifiier:FJ861276) tkordula@vcu.edu Accepted 2018-JUN-26 AT 13:26 BST AT 13:26 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation added stat3 interaction (Fig s4) and GO term chi3l1-nfi-stat_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGCTTCATTGACACATAGCTCAGTTCCCATAAAAGGG stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 chi3l1_human_gene Chitinase-3-like protein 1 CHI3L1 gene gene human Homo sapiens Human fosl1_human Fos-related antigen 1 FOSL1 FRA1 protein protein human Homo sapiens Human MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL DIP protein P15407 original sequence version: 146 1B6492D709E66570 q14938-4 Nuclear factor 1 X-type CCAAT-box-binding transcription factor Nuclear factor I/X TGGCA-binding protein NFIX protein protein human Homo sapiens Human MDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPNGSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNFLNIPQQSQSWFL 8924298844FFA791 chi3l1-ap1_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GATCTCGGCTGAGTCACATCA jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 q14938-3 Nuclear factor 1 X-type Nuclear factor I/X TGGCA-binding protein CCAAT-box-binding transcription factor NFIX protein protein human Homo sapiens Human MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASDPGTATF 38CB7326FDC82859 stat1_human Signal transducer and activator of transcription 1-alpha/beta STAT1 Transcription factor ISGF-3 components p91/p84 protein protein human Homo sapiens Human MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV 054A813522364BA6 chi3l1-stat_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGGCTCAGTTCCCATAAAAGGG 678890yuiuio-1 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 7A ch-IP primers added were taken from Fig7 -top image- as first one in methods does not blat to anything. nfix-chi3l1-1 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 7A-2 OSM-oncostatin M 9-08907890 1 16 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-u373 Homo sapiens u373 u373 17 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7B-1 binding was relatively weak. OSM -oncostatin M chi3l1_stat_probe-stat1-1 1 7 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-u373 Homo sapiens u373 u373 17 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7B-2 OSM -oncostatin M binding was relatively weak. chi3l1_stat_probe-stat3-1 1 7 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-u373 Homo sapiens u373 u373 6 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7C OSM -oncostatin M chi3l1_stat_probe-stat1-2 1 16 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-u373 Homo sapiens u373 u373 6 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7C-2 OSM -oncostatin M chi3l1_ap1_probe-stat3-1 1 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7D-1 OSM -oncostatin M It is not clear if "Nuclear extract from astrocytes" was used, as stated in the text above the image and the discussion, or U373-NFI-X3-FLAG cells, as stated in the image text. chi3l1_ap1_probe-fosl1-1 1 9 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7D-2 OSM -oncostatin M It is not clear if "Nuclear extract from astrocytes" was used, as stated in the text above the image and the discussion, or U373-NFI-X3-FLAG cells, as stated in the image text. chi3l1_ap1_probe-fos-1 1 14 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7D-3 OSM -oncostatin M It is not clear if "Nuclear extract from astrocytes" was used, as stated in the text above the image and the discussion, or U373-NFI-X3-FLAG cells, as stated in the image text. chi3l1_ap1_probe-jun-1 1 8 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Figure 7D-4 OSM -oncostatin M It is not clear if "Nuclear extract from astrocytes" was used, as stated in the text above the image and the discussion, or U373-NFI-X3-FLAG cells, as stated in the image text. 567789o78eryeh-1 5 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 8A nfix-stat3-1 5 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 8Ai nfix-stat3-2 4 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 8B nfix-stat3-3 4 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 8B chi3l1_stat_probe-stat1-3 1 16 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] 17 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp. Fig 4 binding was relatively weak. OSM -oncostatin M chi3l1_nfi_stat_probe-stat3-1 1 7 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] 6 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp fig 4 OSM -oncostatin M chi3l1_nfi_stat_probe-stat3-2 1 16 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] 6 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp fig 4i OSM -oncostatin M nfix-stat3-4 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Figure 5 OSM - Oncostatin M nfix-stat3-5 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Figure 5 OSM - Oncostatin M chi3l1_stat_probe-stat1-4 1 7 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] 17 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp. Fig 4 binding was relatively weak. OSM -oncostatin M