UniProt UniProt http://www.uniprot.org TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. PloS one 2010 imex curation Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. Control interaction could not be added as constructs could not be traced. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. jingyuanfang@yahoo.com Accepted 2018-JUL-16 AT 07:52 BST AT 07:52 BST by PPORRAS Human HeLa MATCHMAKER cDNA PloS one 2010 Only protein-protein interactions imex curation imex curation There is no mention of a partial purification of the his-tagged prey, and its quite normal just to throw a cell lysate onto the column so it would not be our normal practice to call this anything other than Physical or add a data-processing comment. Host organism added. TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. PloS one 2010 imex curation Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. Control interaction could not be added as constructs could not be traced. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. jingyuanfang@yahoo.com Accepted 2018-JUL-16 AT 07:52 BST AT 07:52 BST by PPORRAS Human HeLa MATCHMAKER cDNA PloS one 2010 Only protein-protein interactions imex curation imex curation There is no mention of a partial purification of the his-tagged prey, and its quite normal just to throw a cell lysate onto the column so it would not be our normal practice to call this anything other than Physical or add a data-processing comment. Host organism added. TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells. PloS one 2010 imex curation Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao SL., Hong J., Xie ZQ., Tang JT., Su WY., Du W., Chen YX., Lu R., Sun DF., Fang JY. jingyuanfang@yahoo.com,jingyuanfang@yahoo.com. jingyuanfang@yahoo.com Accepted 2018-JUL-16 AT 07:52 BST AT 07:52 BST by PPORRAS Human HeLa MATCHMAKER cDNA PloS one 2010 Only protein-protein interactions imex curation imex curation There is no mention of a partial purification of the his-tagged prey, and its quite normal just to throw a cell lysate onto the column so it would not be our normal practice to call this anything other than Physical or add a data-processing comment. Host organism added. tppc4_human Trafficking protein particle complex subunit 4 Synbindin TRS23 homolog Hematopoietic stem/progenitor cell protein 172 TRAPPC4 SBDN CGI-104 HSPC172 PTD009 protein protein human Homo sapiens Human MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS C6ADE525B7CFB731 mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP DIP protein P27361 original sequence version: 171 DIP protein P27361 original sequence version: 101 DIP protein P27361 original sequence version: 124 DIP protein P27361 original sequence version: 129 DIP protein P27361 original sequence version: 143 E6020CE413EC41F7 mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E mapk3-trappc4-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association mapk1-trappc4-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association TRAPPC4 was identified as an ERK2-interacting factor by two-hybrid screening trappc4-mapk1-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association After using an anti-Myc antibody for co-immunoprecipitation, both the TRAPPC4-myc band and ERK2-flag band were detected from the pCDEF-Myc-TRAPPC4 and pCDEF-Flag-ERK2 co-transfected cells, indicating there is an interaction between TRAPPC4 and ERK2. Fig. 1A mapk1-trappc4-2 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association TRAPPC4 was pulled down with GST-ERK2 fusion proteins (Fig. 1B, lane c), but not with GST alone (Fig. 1B, lane b), Fig. 1B