IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly. Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly. The Journal of biological chemistry 2010 imex curation Fresquet M., Jowitt TA., Stephen LA., Ylöstalo J., Briggs MD. at the time of curation supplementary materials were not available. Figure 6 not annotated because alpha chain type and origin species of collagen type VI are not provided in the manuscript. sent email to author (12/11/2018)to request alpha chain type and origin species of collage type VI. Author email is not valid anymore. Figure 6 not curated. mike.briggs@manchester.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro qcm quartz crystal microbalance QCM qcm predetermined predetermined participant predetermined Fresquet M., Jowitt TA., Stephen LA., Ylöstalo J., Briggs MD. at the time of curation supplementary materials were not available. Figure 6 not annotated because alpha chain type and origin species of collagen type VI are not provided in the manuscript. sent email to author (12/11/2018)to request alpha chain type and origin species of collage type VI. Author email is not valid anymore. Figure 6 not curated. From ref 15 (PMID:17881354): human matrilin-3 and full-length α1(IX) collagen were used. mike.briggs@manchester.ac.uk Accepted 2019-JAN-31 AT 10:55 GMT AT 10:55 GMT by MARTA The Journal of biological chemistry 2010 imex curation Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly. Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly. The Journal of biological chemistry 2010 imex curation Fresquet M., Jowitt TA., Stephen LA., Ylöstalo J., Briggs MD. at the time of curation supplementary materials were not available. Figure 6 not annotated because alpha chain type and origin species of collagen type VI are not provided in the manuscript. sent email to author (12/11/2018)to request alpha chain type and origin species of collage type VI. Author email is not valid anymore. Figure 6 not curated. mike.briggs@manchester.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fresquet M., Jowitt TA., Stephen LA., Ylöstalo J., Briggs MD. at the time of curation supplementary materials were not available. Figure 6 not annotated because alpha chain type and origin species of collagen type VI are not provided in the manuscript. sent email to author (12/11/2018)to request alpha chain type and origin species of collage type VI. Author email is not valid anymore. Figure 6 not curated. From ref 15 (PMID:17881354): human matrilin-3 and full-length α1(IX) collagen were used. mike.briggs@manchester.ac.uk Accepted 2019-JAN-31 AT 10:55 GMT AT 10:55 GMT by MARTA The Journal of biological chemistry 2010 imex curation co9a1_human Collagen alpha-1(IX) chain COL9A1 protein protein human Homo sapiens Human MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQAGQRAFNKGPDP A69BF076127283D0 matn1_human Cartilage matrix protein MATN1 CMP CRTM Matrilin-1 protein protein human Homo sapiens Human MRVLSGTSLMLCSLLLLLQALCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV 2D880A8114C7940F co2a1_bovin Collagen alpha-1(II) chain COL2A1 Alpha-1 type II collagen protein protein bovin Bos taurus (Bovine) Bovine MIRLGAPQTLVLLTLLVAAVLRCHGQDVQKAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDMKDCLSPETPFGECCPICSADLPTASGQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAAGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGAGPAGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGSQGLQGARGLPGTPGTDGPKGAAGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGTAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPGDDGPSGPDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPIGKQGDRGEAGAQGPMGPAGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQGLPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEAAGNLRQHDAEVDATLKSLNNQIESLRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPASVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTKHTGKWGKTMIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL F99891F6FD1E47F9 matn3_human Matrilin-3 MATN3 protein protein human Homo sapiens Human MPRPAPARRLPGLLLLLWPLLLLPSAAPDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGRARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR 688847BCC791B331 collagenii-matn1a1-1 2 4 unspecified role unspecified role bait bait purified purified region A1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region A2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig.4 These studies demonstrated that whereas 1 mm Zn2+ supported strong binding of type II and IX collagens to the wild type M1A1 and M1A2 domains, in contrast, binding in the presence of 1 mm Mn2+ and Mg2+, or 1 mm EDTA (used as control) was negligible or completely abolished. matn1-col2a1-1 2 4 unspecified role unspecified role bait bait purified purified region A1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig.4 These studies demonstrated that whereas 1 mm Zn2+ supported strong binding of type II and IX collagens to the wild type M1A1 and M1A2 domains, in contrast, binding in the presence of 1 mm Mn2+ and Mg2+, or 1 mm EDTA (used as control) was negligible or completely abolished. matn1-col2a1-2 1 4 unspecified role unspecified role prey prey purified purified P21941:p.Asn344Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 16:58:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn344Ala' region A2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig.5 the Kd provided in this interaction applies to the region [264-453] wt only, not to the full length protein. col2a1-matn1-1 1 4 unspecified role unspecified role prey prey purified purified P21941:p.Asn76Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 17:32:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn76Ala' region A1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig.5 the Kd provded in this interaction applies to the region [23-222] wt only, not to the full length protein. col2a1-matn1-2 1 6 unspecified role unspecified role prey prey purified purified region A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig.5