UniProt UniProt http://www.uniprot.org Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. The Journal of biological chemistry 2008 imex curation Seko A., Yamashita K. kyamashi@bio.titech.ac.jp 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro glycosylase assay glycosylase assay predetermined predetermined participant predetermined Seko A., Yamashita K. Reaction was monitored via the addition of [3H]-UDP-N-acetyl-α-D-glucosamine (CHEBI:16264) to the TetraGP substrate. kyamashi@bio.titech.ac.jp Accepted 2018-AUG-20 AT 15:27 BST AT 15:27 BST by LUANA The Journal of biological chemistry 2008 Only protein-protein interactions imex curation imex curation Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. The Journal of biological chemistry 2008 imex curation Seko A., Yamashita K. kyamashi@bio.titech.ac.jp 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seko A., Yamashita K. kyamashi@bio.titech.ac.jp Accepted 2018-AUG-20 AT 15:27 BST AT 15:27 BST by LUANA The Journal of biological chemistry 2008 Only protein-protein interactions imex curation imex curation b3gn2_mouse N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 B3GNT2 B3gnt1 Beta3gnt Beta-1,3-N-acetylglucosaminyltransferase 1 Beta-1,3-galactosyltransferase 7 Beta-3-Gx-T7 UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 7 protein protein mouse Mus musculus Mouse MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC D8BBEA1866C1D106 b3gn8_human UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3GNT8 B3GALT7 BGALT15 protein protein human Homo sapiens Human MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLPGGGGSQVSSCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRLLFLLGSPVGEAGPDLDSLVAWESRRYSDLLLWDFLDVPFNQTLKDLLLLAWLGRHCPTVSFVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQAMPLRKPGGPFYVPESFFEGGYPAYASGGGYVIAGRLAPWLLRAAARVAPFPFEDVYTGLCIRALGLVPQAHPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC AC0CCE6880F46850 gal(1-4)glcnac(1-4)man3glcnac2 Gal(1-4)GlcNAc(1-4)Man3GlcNAc2 tetraGP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) b3gn8_mouse UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3gnt8 B3galt7 protein protein mouse Mus musculus Mouse MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPNAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYPQELRRFLLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPLGMGGPDLRSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHCPDVNFVLQVQDDAFVHIPALLEHLQTLPPTWARSLYLGEIFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAPRAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIWLWRHLWVPELQC 62ACD86829600D1C b3gn2_human N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 B3GALT7 B3GNT1 Beta-1,3-N-acetylglucosaminyltransferase 1 Beta-1,3-galactosyltransferase 7 Beta-3-Gx-T7 UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7 UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 7 protein protein human Homo sapiens Human MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC B104ECCAE26DC4AC b3gnt2-b3gnt8-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q7Z7M8:p.Gln246Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 17:54:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln246Ala' 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9NY97:p.Asp245Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 19:49:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp245Ala' physical association physical association β3Gn-T2 FLAG tagged at the C terminus (T2-FL) and β3Gn-T8 myc tagged at the C terminus (T8-myc) were simultaneously expressed in COS-7 cells, and the cell lysates were immunoprecipitated by anti-myc antibody. Fig 1 b3gnt2-b3gnt8-2 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 4 enzyme regulator enzyme regulator unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q7Z7M8:p.Gln246Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 20:16:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln246Ala' region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 enzyme enzyme unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Fig 3, Table 1 b3gnt2-gal(1_4)glcnac(1_4)man3glcnac2-1 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 7 enzyme enzyme unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range Q9NY97:p.Asp245Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 19:32:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp245Ala' picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Fig 3 b3gnt2-gal(1_4)glcnac(1_4)man3glcnac2-2 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 3 enzyme enzyme unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Fig 3 b3gnt2-b3gnt8-3 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 4 enzyme regulator enzyme regulator unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3 enzyme enzyme unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Table 1 b3gnt2-b3gnt8-4 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme regulator enzyme regulator unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 enzyme enzyme unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Table 1 b3gnt2-b3gnt8-5 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme regulator enzyme regulator unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3 enzyme enzyme unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined picpa Pichia pastoris (Yeast) Yeast Pichia pastoris glycosylation glycosylation reaction glycosylation Table 1