IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? PloS one 2007 imex curation Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease stella@cc.huji.ac.il 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease from ref 19 alpha-actinin 1 is human stella@cc.huji.ac.il Accepted 2019-JAN-10 AT 09:25 GMT AT 09:25 GMT by ORCHARD PloS one 2007 imex curation UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? PloS one 2007 imex curation Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease stella@cc.huji.ac.il 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease stella@cc.huji.ac.il Accepted 2019-JAN-10 AT 09:25 GMT AT 09:25 GMT by ORCHARD PloS one 2007 imex curation UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) binds to alpha-actinin 1: novel pathways in skeletal muscle? PloS one 2007 imex curation Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease stella@cc.huji.ac.il 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Amsili S., Zer H., Hinderlich S., Krause S., Becker-Cohen M., MacArthur DG., North KN., Mitrani-Rosenbaum S. Rare diseases - Interactions investigated in the context of Rare genetic disease A freshly prepared lysate from human primary skeletal muscle culture cells was fractionated by anion-exchange chromatography to produce 26 fractions (Figure 1A). Interaction between GNE and the different fractions was tested using SPR technology. Freshly prepared normal and mutant (M712T) GNE proteins were immobilized on a CM5 chip. Two pools of positive fractions (#11–13 and #14–16) were further analyzed by in vitro binding assay.The pooled fractions (#11–13 and #14–16) were incubated with GNE-bound nickel beads, resolved by a gradient SDS-PAGE and visualized by Gelcode reagent staining (Figure 2). The candidate bands, as well as the corresponding gel-areas or bands of the negative-controls, were cut from the gel for analysis by MS. stella@cc.huji.ac.il Accepted 2019-JAN-10 AT 09:25 GMT AT 09:25 GMT by ORCHARD PloS one 2007 imex curation glcne_human Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase GNE GLCNE UDP-GlcNAc-2-epimerase/ManAc kinase protein protein human Homo sapiens Human MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALATSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILLAGCPSYDKLLSAKNKDYMSIIRMWLGDDVKSKDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRILGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY 4D7D049B06B00077 actn1_human Alpha-actinin-1 ACTN1 Alpha-actinin cytoskeletal isoform Non-muscle alpha-actinin-1 F-actin cross-linking protein protein protein human Homo sapiens Human MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 6DA3E4D1A0289519 ldhb_human L-lactate dehydrogenase B chain LDHB LDH heart subunit Renal carcinoma antigen NY-REN-46 protein protein human Homo sapiens Human MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL 3AD605DEED0D54A2 gne-actinin-ldhb-1 3 5 unspecified role unspecified role prey prey partially purified partially purified human-skeletal-muscle Homo sapiens skeletal muscle. skeletal_muscle Skeletal muscle 6 unspecified role unspecified role prey prey partially purified partially purified human-skeletal-muscle Homo sapiens skeletal muscle. skeletal_muscle Skeletal muscle 4 unspecified role unspecified role bait bait purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Fig.1, Fig.2, Table1 act-gne-1 1 5 unspecified role unspecified role prey prey purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait purified purified Q9Y223:p.Met712Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M T Tue Jun 30 19:25:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met712Thr' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Table2, Fig.3, Fig.4 gne-actn1-1 2 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B