IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Cell 2008 imex curation Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. ygshi@princeton.edu 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. ygshi@princeton.edu Accepted 2018-FEB-28 AT 11:05 GMT AT 11:05 GMT by ORCHARD Cell 2008 Only protein-protein interactions imex curation imex curation OK - I have altered and added Identification Menthod for the Mn2+ ions as "ms parcticipant" as I cannot see anything better to add as. Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Cell 2008 imex curation Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. ygshi@princeton.edu 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. After fractionation using size exclusion chromatography the levels of Mn2+ bound to PP2A or PP2A-PME-1 complex were quantified by ICP-MS (Inductively coupled plasma mass spectrometry- a method capable of detecting metals at low concentrations). ygshi@princeton.edu Accepted 2018-FEB-28 AT 11:05 GMT AT 11:05 GMT by ORCHARD Cell 2008 Only protein-protein interactions imex curation imex curation OK - I have altered and added Identification Menthod for the Mn2+ ions as "ms parcticipant" as I cannot see anything better to add as. Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Cell 2008 imex curation Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. ygshi@princeton.edu 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study tag visualisation tag visualisation Xing Y., Li Z., Chen Y., Stock JB., Jeffrey PD., Shi Y. Results from Phosphatase Assays have not been included as the identity and origin of "phosphorylase a" substrate cannot be traced. as well as "the identity and origin of phosphorylase a" not being stated, there is no method given for this assay, nor in the same author's 2006 publication/reference. Methylesterase assay:PPP2CA methylated by LCMT1 is a substrate for PME-1. ygshi@princeton.edu Accepted 2018-FEB-28 AT 11:05 GMT AT 11:05 GMT by ORCHARD Cell 2008 Only protein-protein interactions imex curation imex curation OK - I have altered and added Identification Menthod for the Mn2+ ions as "ms parcticipant" as I cannot see anything better to add as. 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 phenylmethanesulfonyl fluoride phenylmethanesulfonyl fluoride alpha-toluenesulfonyl fluoride alpha-toluenesulphonyl fluoride Benzenemethanesulfonyl fluoride Phenylmethanesulfonyl fluoride phenylmethylsulfonyl fluoride PMSF phenylmethanesulfonyl fluoride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ppme1_human Protein phosphatase methylesterase 1 PPME1 PME1 PP2593 PRO0750 protein protein human Homo sapiens Human MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC 37B25324583E8578 manganese(2+) Manganese (2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 ppme1-ppp2ca-1 1 8 unspecified role unspecified role neutral component neutral component purified purified possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role neutral component neutral component purified purified heat_domains_1,11-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified Q9Y570:p.Ser156Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:22:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156ala' Tue Jun 30 16:20:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table 1 2.8A RFree = 0.263 RWork= 0.195 ppme1-ppp2ca-2 3 6 enzyme enzyme neutral component neutral component purified purified Q9Y570:p.Ser156Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:33:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156ala' Tue Jun 30 17:52:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Ala' Q9Y570:p.Ser156Thr mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S T Wed May 02 14:48:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156thr' Tue Jun 30 19:42:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Thr' Q9Y570:p.Ser156Cys mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S C Wed May 02 20:08:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156cys' Tue Jun 30 16:23:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Cys' Q9Y570:p.Asp181Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:05:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp181ala' Tue Jun 30 17:32:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp181Ala' Q9Y570:p.Asp181Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:04:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp181asn' Tue Jun 30 16:54:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp181Asn' Q9Y570:p.His349Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain H A Wed May 02 19:07:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his349ala' Tue Jun 30 17:22:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His349Ala' Q9Y570:p.His155Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain H A Wed May 02 15:36:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his155ala' Tue Jun 30 17:51:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His155Ala' n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y570:p.Arg369Asp mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R D Wed May 02 14:59:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg369asp' Tue Jun 30 18:03:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg369Asp' ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified leu-309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range leu-309 3h radiolabel 3h radiolabel 3H tritium H3 certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role ancillary ancillary purified purified heat_domains_1,11-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 4D and Supplementary figure 1,2,3. ppme1-ppp2ca-3 3 5 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified delta_carboxy_terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Supplementary figure 3 PMSF only inactivated PME-1 that was pre-incubated with a PP2A core enzyme involving truncation of the carboxy- terminus of the catalytic subunit. ppme1-ppp2ca-4 2 7 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 6 inhibitor inhibitor neutral component neutral component purified purified Q9Y570:p.Met335Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M D Wed May 02 20:26:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met335asp' Tue Jun 30 19:12:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met335Asp' n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) physical association physical association Supplementary figure 4A-2 ppme1-ppp2ca-5 2 8 unspecified role unspecified role neutral component neutral component purified purified possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) 7 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supplementary figure 4A-1