IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ERRbeta: a potent inhibitor of Nrf2 transcriptional activity. ERRbeta: a potent inhibitor of Nrf2 transcriptional activity. Molecular and cellular endocrinology 2007 imex curation Zhou W., Lo SC., Liu JH., Hannink M., Lubahn DB. Origin of Nrf2 was found in PMID: 7937919 ERRbeta -short-form sequence corresponds to O95718-3. LubahnD@missouri.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou W., Lo SC., Liu JH., Hannink M., Lubahn DB. Origin of Nrf2 was found in PMID: 7937919 ERRbeta -short-form sequence corresponds to O95718-3. LubahnD@missouri.edu Accepted 2018-JUN-11 AT 12:10 BST AT 12:10 BST by PPORRAS Molecular and cellular endocrinology 2007 Only protein-protein interactions imex curation imex curation ERRbeta: a potent inhibitor of Nrf2 transcriptional activity. ERRbeta: a potent inhibitor of Nrf2 transcriptional activity. Molecular and cellular endocrinology 2007 imex curation Zhou W., Lo SC., Liu JH., Hannink M., Lubahn DB. Origin of Nrf2 was found in PMID: 7937919 ERRbeta -short-form sequence corresponds to O95718-3. LubahnD@missouri.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Zhou W., Lo SC., Liu JH., Hannink M., Lubahn DB. Origin of Nrf2 was found in PMID: 7937919 ERRbeta -short-form sequence corresponds to O95718-3. LubahnD@missouri.edu Accepted 2018-JUN-11 AT 12:10 BST AT 12:10 BST by PPORRAS Molecular and cellular endocrinology 2007 Only protein-protein interactions imex curation imex curation nf2l2_human Nuclear factor erythroid 2-related factor 2 NFE2L2 NRF2 Nuclear factor, erythroid derived 2, like 2 HEBP1 protein protein human Homo sapiens Human MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN DIP protein Q16236 original sequence version: 80 DIP protein Q16236 original sequence version: 103 DIP protein Q16236 original sequence version: 148 DIP protein Q16236 original sequence version: 102 DIP protein Q16236-1 original sequence version: 113 99FAFD811B6C1416 o95718-3 Steroid hormone receptor ERR2 ESRRB ERR beta-2 Estrogen receptor-like 2 Estrogen-related receptor beta Nuclear receptor subfamily 3 group B member 2 ERRbeta-short-form ERRB2 ESRL2 NR3B2 protein protein human Homo sapiens Human MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV ED1D3F87E2798DD1 3456wertsey-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 7,9 at least two sites, one likely located within the D domain and one within the A/B-C domains of SFhERR-beta are capable of interacting with Nrf2. At least two sites, one likely located within the D domain and one within the A/B-C domains of SFhERR-beta are capable of interacting with Nrf2. esrrb-nfe2l2-1 2 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 6B 77.7% of the HA-Nrf2 positively stained cells showed that HA-Nrf2 translocated into the nucleus and co-localized with SFhERR-beta. 77.7% of the HA-Nrf2 positively stained cells showed that HA-Nrf2 translocated into the nucleus and co-localized with SFhERR-beta.