IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Biochemical and biophysical research communications 2007 imex curation Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PME-1 stated to be Human somewhere in the text.(near end of discussion!) I have NOT added Fig 2A enzyme assay as HeLa cell extract used could be a source of demethylating enzymes. Supp fig 1 shows that the dimer/trimer have "OMe" group present throughout- so added as an "observed PTM" except for DeMEthlyase interactions when it is "required". tikehara@ttc.co.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PP2A-dimer purification -as given in Ref 21- involved Affinity chromatography using Ni–NTA agarose followed by anti-M2 FLAG agarose. The trimer is stated to have been purified using the same method. tikehara@ttc.co.jp Accepted 2018-FEB-23 AT 13:35 GMT AT 13:35 GMT by LIVIAP Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation EBI-16768389:- the LHS image - with "+PME-1" is shown here, as an enzyme assay showing the decrease in methylation of catalytic subunit, in the presence of PME-1, by a methylation specific antibody. The RHS image has NO PME-1 present, so is not an Enzyme assay - is an anti-tag IP only - and is in the other experiment, as noted. I have altered the Interaction Type to ~"Enzymatic Reaction" - it should NOT have been an Association - must have forgotten to alter it.; These proteins are purified, these interactions are also described elsewhere, (in other experiments) so according to the manual (p23) these interactions CAN be curated.; Yes - I dont know if it should be Association or Physical Assoc. either! As you say, we should discuss with Pablo, (and maybe Sandra?) as I dont think there is anything in Manual (or elsewhere) about this. Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Biochemical and biophysical research communications 2007 imex curation Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PME-1 stated to be Human somewhere in the text.(near end of discussion!) I have NOT added Fig 2A enzyme assay as HeLa cell extract used could be a source of demethylating enzymes. Supp fig 1 shows that the dimer/trimer have "OMe" group present throughout- so added as an "observed PTM" except for DeMEthlyase interactions when it is "required". tikehara@ttc.co.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PP2A-dimer purification -as given in Ref 21- involved Affinity chromatography using Ni–NTA agarose followed by anti-M2 FLAG agarose. The trimer is stated to have been purified using the same method. tikehara@ttc.co.jp Accepted 2018-FEB-23 AT 13:35 GMT AT 13:35 GMT by LIVIAP Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation EBI-16768389:- the LHS image - with "+PME-1" is shown here, as an enzyme assay showing the decrease in methylation of catalytic subunit, in the presence of PME-1, by a methylation specific antibody. The RHS image has NO PME-1 present, so is not an Enzyme assay - is an anti-tag IP only - and is in the other experiment, as noted. I have altered the Interaction Type to ~"Enzymatic Reaction" - it should NOT have been an Association - must have forgotten to alter it.; These proteins are purified, these interactions are also described elsewhere, (in other experiments) so according to the manual (p23) these interactions CAN be curated.; Yes - I dont know if it should be Association or Physical Assoc. either! As you say, we should discuss with Pablo, (and maybe Sandra?) as I dont think there is anything in Manual (or elsewhere) about this. Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Biochemical and biophysical research communications 2007 imex curation Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PME-1 stated to be Human somewhere in the text.(near end of discussion!) I have NOT added Fig 2A enzyme assay as HeLa cell extract used could be a source of demethylating enzymes. Supp fig 1 shows that the dimer/trimer have "OMe" group present throughout- so added as an "observed PTM" except for DeMEthlyase interactions when it is "required". tikehara@ttc.co.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) methylesterase assay tikehara@ttc.co.jp Accepted 2018-FEB-23 AT 13:35 GMT AT 13:35 GMT by LIVIAP Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation EBI-16768389:- the LHS image - with "+PME-1" is shown here, as an enzyme assay showing the decrease in methylation of catalytic subunit, in the presence of PME-1, by a methylation specific antibody. The RHS image has NO PME-1 present, so is not an Enzyme assay - is an anti-tag IP only - and is in the other experiment, as noted. I have altered the Interaction Type to ~"Enzymatic Reaction" - it should NOT have been an Association - must have forgotten to alter it.; These proteins are purified, these interactions are also described elsewhere, (in other experiments) so according to the manual (p23) these interactions CAN be curated.; Yes - I dont know if it should be Association or Physical Assoc. either! As you say, we should discuss with Pablo, (and maybe Sandra?) as I dont think there is anything in Manual (or elsewhere) about this. Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Methylation of the C-terminal leucine residue of the PP2A catalytic subunit is unnecessary for the catalytic activity and the binding of regulatory subunit (PR55/B). Biochemical and biophysical research communications 2007 imex curation Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) PME-1 stated to be Human somewhere in the text.(near end of discussion!) I have NOT added Fig 2A enzyme assay as HeLa cell extract used could be a source of demethylating enzymes. Supp fig 1 shows that the dimer/trimer have "OMe" group present throughout- so added as an "observed PTM" except for DeMEthlyase interactions when it is "required". tikehara@ttc.co.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. Imex ID Added manually - cannot assign an IMEX ID - message = " Impossible to assign new IMEx idjava.lang.NullPointerException". problem is at Imex Central - awaiting Luckashzz to fix.(?) tikehara@ttc.co.jp Accepted 2018-FEB-23 AT 13:35 GMT AT 13:35 GMT by LIVIAP Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation EBI-16768389:- the LHS image - with "+PME-1" is shown here, as an enzyme assay showing the decrease in methylation of catalytic subunit, in the presence of PME-1, by a methylation specific antibody. The RHS image has NO PME-1 present, so is not an Enzyme assay - is an anti-tag IP only - and is in the other experiment, as noted. I have altered the Interaction Type to ~"Enzymatic Reaction" - it should NOT have been an Association - must have forgotten to alter it.; These proteins are purified, these interactions are also described elsewhere, (in other experiments) so according to the manual (p23) these interactions CAN be curated.; Yes - I dont know if it should be Association or Physical Assoc. either! As you say, we should discuss with Pablo, (and maybe Sandra?) as I dont think there is anything in Manual (or elsewhere) about this. 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 2abb_human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform PP2A subunit B isoform beta PP2A subunit B isoform B55-beta PP2A subunit B isoform PR55-beta PPP2R2B PP2A subunit B isoform R2-beta protein protein human Homo sapiens Human MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN C383C834B2852B8F ppme1_human Protein phosphatase methylesterase 1 PPME1 PME1 PP2593 PRO0750 protein protein human Homo sapiens Human MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC 37B25324583E8578 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 ppme1-ppp2ca-6 3 7 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role ancillary ancillary purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 1A ppme1-ppp2ca-7 4 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role ancillary ancillary purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:31:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309ala' Tue Jun 30 16:26:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309Ala' P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L . Wed May 02 18:32:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309del' Tue Jun 30 19:54:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309del' leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Figure 2A, 3B The "B" (regulatory) subunit bound to methylated and demethylated PP2AD. ppp2r1a-ppp2r2b-1 3 7 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 ancillary ancillary neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 ancillary ancillary neutral component neutral component purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 2B Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppme1-ppp2ca-8 2 6 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. association association Figure 2Bi Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppp2r1a-ppp2ca-6 1 6 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 unspecified role unspecified role prey prey purified purified leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:10:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309ala' Tue Jun 30 18:52:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309Ala' P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L . Wed May 02 20:04:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309del' Tue Jun 30 16:05:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309del' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. association association Figure 3A (Supp figure 1) Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppp2r1a-ppp2ca-7 1 8 unspecified role unspecified role prey prey purified purified leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:52:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309ala' Tue Jun 30 18:39:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309Ala' P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L . Wed May 02 14:41:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu309del' Tue Jun 30 18:36:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu309del' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Figure 3A-2 (supp figure 1) Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit.