IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Nucleic Acids Research 2006 imex curation Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr Accepted 2018-DEC-14 AT 14:20 GMT AT 14:20 GMT by PPORRAS Nucleic Acids Research 2006 imex curation Honestly I don't see a reason why I cannot leave there a generic 'human'. I've changed the data-proc to a caution as the example in the manual.; pull down moved to the correct experiment. EBI-21005356 and EBI-21005288 are different, in one case prey is endogenous in the othe is overexpressed. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Nucleic Acids Research 2006 imex curation Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr Accepted 2018-DEC-14 AT 14:20 GMT AT 14:20 GMT by PPORRAS Nucleic Acids Research 2006 imex curation Honestly I don't see a reason why I cannot leave there a generic 'human'. I've changed the data-proc to a caution as the example in the manual.; pull down moved to the correct experiment. EBI-21005356 and EBI-21005288 are different, in one case prey is endogenous in the othe is overexpressed. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Nucleic Acids Research 2006 imex curation Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr Accepted 2018-DEC-14 AT 14:20 GMT AT 14:20 GMT by PPORRAS Nucleic Acids Research 2006 imex curation Honestly I don't see a reason why I cannot leave there a generic 'human'. I've changed the data-proc to a caution as the example in the manual.; pull down moved to the correct experiment. EBI-21005356 and EBI-21005288 are different, in one case prey is endogenous in the othe is overexpressed. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Nucleic Acids Research 2006 imex curation Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr Accepted 2018-DEC-14 AT 14:20 GMT AT 14:20 GMT by PPORRAS Nucleic Acids Research 2006 imex curation Honestly I don't see a reason why I cannot leave there a generic 'human'. I've changed the data-proc to a caution as the example in the manual.; pull down moved to the correct experiment. EBI-21005356 and EBI-21005288 are different, in one case prey is endogenous in the othe is overexpressed. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. Nucleic Acids Research 2006 imex curation Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN., Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund JN. Cell line in this experiment is not specified. not clear what cell line was used but aithors only employed human cell lines in this publication, so I've kept a generic human' as host organism. Info on origin species of murine CDX1 and human TBP were obtained from ref. 8 and ref. 19 respectively. interactions involving Chimeric proteins were not annotated according to IMEx rules. Spm3 mutant of TBP (I194F,V203T,L205V) was obtained from reference 27. Amino acidic positions were remapped to the current UniProt canonical sequence. jean-noel.freund@inserm.u-strasbg.fr Accepted 2018-DEC-14 AT 14:20 GMT AT 14:20 GMT by PPORRAS Nucleic Acids Research 2006 imex curation Honestly I don't see a reason why I cannot leave there a generic 'human'. I've changed the data-proc to a caution as the example in the manual.; pull down moved to the correct experiment. EBI-21005356 and EBI-21005288 are different, in one case prey is endogenous in the othe is overexpressed. cdx1_mouse Homeobox protein CDX-1 Caudal-type homeobox protein 1 Cdx1 Cdx-1 protein protein mouse Mus musculus Mouse MYVGYVLDKDSPVYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDWAAAYGPGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTPYEWMRRSVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP 85F45B2A3E12B2AE cdx1_human Homeobox protein CDX-1 CDX1 Caudal-type homeobox protein 1 protein protein human Homo sapiens Human MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP Could play a role in the terminal differentiation of the intestine mint 484CB284E3357BC6 taf7_human Transcription initiation factor TFIID subunit 7 Transcription initiation factor TFIID 55 kDa subunit RNA polymerase II TBP-associated factor subunit F TAF7 TAF2F TAFII55 protein protein human Homo sapiens Human MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK DIP protein Q15545 original sequence version: 127 DIP protein Q15545 original sequence version: 53 DIP protein Q15545 original sequence version: 71 DIP protein Q15545 original sequence version: 113 0AAFD3E33E3CCD6E rbp56_human TATA-binding protein-associated factor 2N TAF15 RBP56 TAF2N RNA-binding protein 56 68 kDa TATA-binding protein-associated factor protein protein human Homo sapiens Human MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY DIP protein Q92804 original sequence version: 146 73D37C171E1E2BCA tmed7_human Transmembrane emp24 domain-containing protein 7 TMED7 CGI-109 p24 family protein gamma-3 p27 protein protein human Homo sapiens Human MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS 9D0D2110579837B3 tbp_human TATA-box-binding protein TBP TF2D TFIID GTF2D1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein human Homo sapiens Human MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT DIP protein P20226 original sequence version: 106 DIP protein P20226 original sequence version: 157 DIP protein P20226 original sequence version: 173 DIP protein P20226 original sequence version: 194 DIP protein P20226 original sequence version: 179 DIP protein P20226 original sequence version: 131 A61A578D972B970B taf12_human Transcription initiation factor TFIID subunit 12 TAF12 TAF15 TAF2J TAFII20 Transcription initiation factor TFIID 20/15 kDa subunits protein protein human Homo sapiens Human MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 054B017CD7BF99CE tab-cdx1-1 2 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind range range certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A, Fig. 3C, Fig.2D CHEBI:4883 - ethidium bromide cdx1-tbp-2 4 11 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C cdx1-tbp-1 2 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4D cdx1-med7-1 2 9 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 12 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2C tbp-taf12-1 2 9 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 12 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 6 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2C cdx1-tbp-4 1 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 physical association physical association Fig. 2A cdx1-tbp-5 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P20226:p.[Ile292Phe;Val301Thr;Leu303Val] Spm3(I194F,V203T,L205V) mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain V T certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 18:25:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile292Phe;Val301Thr;Leu303Val]' human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 physical association physical association Fig. 1B, Fig. 5B cdx1-tbp-6 5 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 11 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4B