IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ligand binding sites of inducible costimulator and high avidity mutants with improved function. Ligand binding sites of inducible costimulator and high avidity mutants with improved function. The Journal of experimental medicine 2002 imex curation Wang S., Zhu G., Tamada K., Chen L., Bajorath J. chen.lieping@mayo.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Wang S., Zhu G., Tamada K., Chen L., Bajorath J. Results from Figure 2A/Table 1 using artificial chimeric proteins (CD28/ICOS replacement) have not been entered following IMEx curation guidelines. chen.lieping@mayo.edu Accepted 2018-JAN-19 AT 12:34 GMT AT 12:34 GMT by PPORRAS The Journal of experimental medicine 2002 Only protein-protein interactions imex curation imex curation Ligand binding sites of inducible costimulator and high avidity mutants with improved function. Ligand binding sites of inducible costimulator and high avidity mutants with improved function. The Journal of experimental medicine 2002 imex curation Wang S., Zhu G., Tamada K., Chen L., Bajorath J. chen.lieping@mayo.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang S., Zhu G., Tamada K., Chen L., Bajorath J. chen.lieping@mayo.edu Accepted 2018-JAN-19 AT 12:34 GMT AT 12:34 GMT by PPORRAS The Journal of experimental medicine 2002 Only protein-protein interactions imex curation imex curation done icosl_human ICOS ligand ICOSLG B7 homolog 2 B7-like protein Gl50 B7-related protein 1 B7H2 B7RP1 ICOSL KIAA0653 protein protein human Homo sapiens Human MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV 647934E21B55E34A icos_human Inducible T-cell costimulator ICOS AILIM Activation-inducible lymphocyte immunomediatory molecule protein protein human Homo sapiens Human MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL 214EC741C9BDC9FC icoslg-icos-1 1 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey conditioned medium conditioned medium Q9Y6W8:p.Phe51Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F S Wed May 02 18:35:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe51ser' Tue Jun 30 17:34:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe51Ser' Q9Y6W8:p.Lys69Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K S Wed May 02 20:21:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys69ser' Tue Jun 30 19:51:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys69Ser' Q9Y6W8:p.Asp115Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D S Wed May 02 18:20:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp115ser' Tue Jun 30 20:22:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp115Ser' Q9Y6W8:p.Pro117Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P S Wed May 02 15:19:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro117ser' Tue Jun 30 18:12:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro117Ser' Q9Y6W8:p.Phe119Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F S Wed May 02 14:51:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe119ser' Tue Jun 30 18:23:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe119Ser' Q9Y6W8:p.Gln49Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q S Wed May 02 14:57:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln49ser' Tue Jun 30 19:52:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln49Ser' region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind range range range range Q9Y6W8:p.Lys52Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K S Wed May 02 17:11:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys52ser' Tue Jun 30 18:23:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys52Ser' Q9Y6W8:p.Ser76Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E Wed May 02 15:00:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser76glu' Tue Jun 30 19:46:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser76Glu' Q9Y6W8:p.Phe114Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F S Wed May 02 15:12:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe114ser' Tue Jun 30 19:54:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe114Ser' Q9Y6W8:p.Gln50Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q S Wed May 02 16:01:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln50ser' Tue Jun 30 19:00:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln50Ser' Q9Y6W8:p.Lys67Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K S Wed May 02 15:09:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys67ser' Tue Jun 30 20:07:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys67Ser' Q9Y6W8:p.Asp64Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D S Wed May 02 15:30:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp64ser' Tue Jun 30 19:56:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp64Ser' chlae-cos Chlorocebus aethiops cos cos physical association physical association Figure 2B-D, Table 1 icoslg-icos-2 1 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey purified purified Q9Y6W8:p.Gln49Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q S Wed May 02 20:05:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln49ser' Tue Jun 30 16:12:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln49Ser' Q9Y6W8:p.Pro117Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P S Wed May 02 17:28:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro117ser' Tue Jun 30 19:19:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro117Ser' region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind range range range range Q9Y6W8:p.Lys52Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K S Wed May 02 16:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys52ser' Tue Jun 30 16:58:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys52Ser' Q9Y6W8:p.Ser76Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E Wed May 02 15:11:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser76glu' Tue Jun 30 20:02:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser76Glu' chlae-cos Chlorocebus aethiops cos cos direct interaction direct interaction Figure 2E, Table 1 icoslg-icos-3 2 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey purified purified Q9Y6W8:p.Pro117Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P S Wed May 02 16:38:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro117ser' Tue Jun 30 20:18:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro117Ser' region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind range range range range Q9Y6W8:p.Ser76Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E Wed May 02 15:12:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser76glu' Tue Jun 30 19:37:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser76Glu' chlae-cos Chlorocebus aethiops cos cos direct interaction direct interaction Figure 3