UniProt UniProt http://www.uniprot.org GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. Nature 1999 imex curation Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu Accepted 2017-JUN-07 AT 11:19 BST AT 11:19 BST by MGT Nature 1999 imex curation GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. Nature 1999 imex curation Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu Accepted 2017-JUN-07 AT 11:19 BST AT 11:19 BST by MGT Nature 1999 imex curation GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. Nature 1999 imex curation Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW., Wang H., Bedford FK., Brandon NJ., Moss SJ., Olsen RW. Colocaization data in rat brain by immunocytochemistry. omitted since the used GABA(A) receptor subunits is not specific. Experiments using tubulin omitted since its source cannot be traced.. rolsen@mednet.ucla.edu Accepted 2017-JUN-07 AT 11:19 BST AT 11:19 BST by MGT human fetal brain cDNA Nature 1999 imex curation gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 p18507-1 Gamma-aminobutyric acid receptor subunit gamma-2 GABRG2 GABA(A) receptor subunit gamma-2 protein protein human Homo sapiens Human MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL 7450DFE1157C9224 p18507-2 Gamma-aminobutyric acid receptor subunit gamma-2 GABRG2 GABA(A) receptor subunit gamma-2 protein protein human Homo sapiens Human MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL DE142F62846576DF gabrg2-gabarap-1 3 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure gabrg2-gabarap-2 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1a gabrg2-gabarap-3 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1a gabrg2-gabarap-4 2 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 2c gabrg2-gabarap-5 2 6 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2d