DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. Nature 1998 imex curation Kaffman A., Rank NM., O'Neill EM., Huang LS., O'Shea EK. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kaffman A., Rank NM., O'Neill EM., Huang LS., O'Shea EK. DIP original experiment: DIP-265153X Nature 1998 IMEx The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. Nature 1998 imex curation Kaffman A., Rank NM., O'Neill EM., Huang LS., O'Shea EK. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain Kaffman A., Rank NM., O'Neill EM., Huang LS., O'Shea EK. DIP original experiment: DIP-265154X Nature 1998 IMEx The receptor Msn5 exports the phosphorylated transcription factor Pho4 out of the nucleus. pho4_yeast Phosphate system positive regulatory protein PHO4 PHO4 YFR034C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGRTTSEGIHGFVDDLEPKSSILDKVGDFITVNTKRHDGREDFNEQNDELNSQENHNSSENGNENENEQDSLALDDLDRAFELVEGMDMDWMMPSHAHHSPATTATIKPRLLYSPLIHTQSAVPVTISPNLVATATSTTSANKVTKNKSNSSPYLNKRRGKPGPDSATSLFELPDSVIPTPKPKPKPKQYPKVILPSNSTRRVSPVTAKTSSSAEGVVVASESPVIAPHGSSHSRSLSKRRSSGALVDDDKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNVST 6DB93C0DDDB4D741 6DB93C0DDDB4D741 msn5_yeast Protein MSN5 MSN5 D9651.5 YDR335W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSTGASQIVSALDVIYSPKSNNSQRQEAQKFLDEVKLCSESPFWGYEIALQNPTNSILKYFGLGLLDHAVKKNWNDYDEGKRVALRKWVMELNFGVQDYDTRYIKEKLATLWVEVAKRTWGEALKQTNPTEEQLLTSWVDMDNNLFELWNINQSSRELALIIFRILFEDVFLLDDLIVLKRMTVIQPLCVMIVCPIEVFAIKYKFSDKWTKFKANEEGWFSVWIPELNNALQQNNSEYIIRLLETLKTCLNWPLTEVIVRNDVLSSLLTCLSSNIPRAQSMALDSIHILLTRPYSNESHYQMTIDRVFDNMDLLDSVYESLLFDPTDDIDETKYPIIKKFVDMISCLYVCVPKIKETNGQIQKYFKLVLKTTYNPSLIVSGLTLDLWCTCLRNDEYLPKLEKYVIPDLLQFAADALVYYEQIDGHISKKFAEIDFQSKSEFQTFCSTYRKRIRDIIRLISCVELDLTYDWLNNRLNNYFSSPFGQQVLSSTFLDHKLEPYLGALSQYMIVECFINGCIRWKIWYPTGDDYDEKLDSILQKLEILSNQLIALNLREPLLLKKQIQNFALFLTMLKDNVLFTLLEKIITSATMDYPEINLEERGAESDAVRDLRYACGIELNRMALLMPESLKKIYPDLESVIARIMPNLSYHEKISFKSFLLIIVLKSSLDMKEERFAAIVDPELLAWSDKTTVVGLSDLHWFMERLGIVQIAEYFQRRDIDENSDLLSIPIDDEGKELKSELTKRWQSLFPVRATRMFIHYSMQSIKTDEEFKMLQDLWRPRIVPILPYITRLLYQLQSYHDPDNWKGLPTVVQSFVKYSTIERFWEAGASNKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLVLSAISSLGSVFYLLDESPDLLLNSIAIFKPGSNEISPGVSTHGWKHIMNIAIRPILKGCPKDCLGKFMPAFLPKLFEILDLLLCQKWSSHMNDMDMNPVPTDDDQMTEEILEENLLRQLTTVVVRIVIDCVGQGNANPNSAKSRLNNHQMEMRKIIFNDLNTLAPFLKLLNHLISFKDTKCSFNSILVMKCCLTSVLNQNNTVDEYFTFEVMKNLLLNVLCNSAFKDSFHEALYAFTVIFLTLCKEYPSARAFLFEISNGYNIDELYRNLRSVDEYKTQRALMIDFIDWVKSTSGKEDGNVDHAGDERKRQEKREAILKKANERLIKKNKENGDMLDDPNIEDGAVGNLFDDN C47A6767CBA44486 C47A6767CBA44486 gsp1_yeast GTP-binding nuclear protein GSP1/CNR1 CNR1 CST17 GTPase Ran homolog L8003.19 YLR293C GSP1 Genetic suppressor of PRP20-1 Chromosome stability protein 17 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL C9D027033F8C70E1 C9D027033F8C70E1 pho4p-msn5p-1 1 4 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role bait bait P07270:p.[Ser100Ala;Ser114Ala;Ser128Ala;Ser152Ala;Ser223Ala] S to A mutations mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:06:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser100ala,ser114ala,ser128ala,ser152ala,ser223ala' Tue Jun 30 17:10:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser100Ala;Ser114Ala;Ser128Ala;Ser152Ala;Ser223Ala]' zz Tag zz Tag zz tag zz tag ZZ tag ZZ tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction pho4p-gsp1p-1 2 5 unspecified role unspecified role prey prey ecolx Escherichia coli 4 unspecified role unspecified role prey prey ecolx Escherichia coli 3 unspecified role unspecified role bait bait zz Tag zz Tag zz tag zz tag ZZ tag ZZ tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association