IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ NKp44, a novel triggering surface molecule specifically expressed by activated natural killer cells, is involved in non-major histocompatibility complex-restricted tumor cell lysis. NKp44, a novel triggering surface molecule specifically expressed by activated natural killer cells, is involved in non-major histocompatibility complex-restricted tumor cell lysis. The Journal of experimental medicine 1998 imex curation Vitale M., Bottino C., Sivori S., Sanseverino L., Castriconi R., Marcenaro E., Augugliaro R., Moretta L., Moretta A. DSP=?74. First one from PAblo's list. The stated pair is O43914_O95944 - but I found it to be as entered. (p44 does not interact, but p46 (NKp46) does. There is also an interaction with CC 16 - but not specific to any one form of CD16-so not entered. Interaction with CC 16 not recorded because antibody used was not specific to any one form of CD16. miriello@sirio.cba.unige.it 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-nk_cells human-Natural Killer cells Human nk_cells Natural killer cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vitale M., Bottino C., Sivori S., Sanseverino L., Castriconi R., Marcenaro E., Augugliaro R., Moretta L., Moretta A. DSP=?74. First one from PAblo's list. The stated pair is O43914_O95944 - but I found it to be as entered. (p44 does not interact, but p46 (NKp46) does. There is also an interaction with CC 16 - but not specific to any one form of CD16-so not entered. Interaction with CC 16 not recorded because antibody used was not specific to any one form of CD16. miriello@sirio.cba.unige.it Accepted 2017-AUG-08 AT 16:58 BST AT 16:58 BST by PPORRAS The Journal of experimental medicine 1998 Only protein-protein interactions imex curation imex curation nctr1_human Natural cytotoxicity triggering receptor 1 NCR1 LY94 Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein protein protein human Homo sapiens Human MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL FBCBDE50D2F34CD3 cd3e_human T-cell surface glycoprotein CD3 epsilon chain CD3E T3E T-cell surface antigen T3/Leu-4 epsilon chain protein protein human Homo sapiens Human MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI A1603D01CE9957D7 ncr1-cd3e-1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 4A