matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Lysosomal integral membrane protein II binds thrombospondin-1. Structure-function homology with the cell adhesion molecule CD36 defines a conserved recognition motif. Lysosomal integral membrane protein II binds thrombospondin-1. Structure-function homology with the cell adhesion molecule CD36 defines a conserved recognition motif. The Journal of biological chemistry 1998 imex curation Crombie R., Silverstein R. 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Crombie R., Silverstein R. Accepted 2020-MAR-03 AT 14:33 GMT AT 14:33 GMT by ORCHARD The Journal of biological chemistry 1998 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method cd36_human Platelet glycoprotein 4 GP3B GP4 Platelet glycoprotein IV Glycoprotein IIIb Leukocyte differentiation antigen CD36 PAS IV PAS-4 Platelet collagen receptor Fatty acid translocase Thrombospondin receptor CD36 protein protein human Homo sapiens Human MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK 543E748259A094FA scrb2_rat Lysosome membrane protein 2 Lysosome membrane protein II Scavenger receptor class B member 2 85 kDa lysosomal membrane sialoglycoprotein CD36 antigen-like 2 Scarb2 Cd36l2 Limpii protein protein rat Rattus norvegicus (Rat) Rat MARCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQSVGDPTVDLIRTINIPLLTVVEMAQQPFLREIIEAMLKAYQQTLFVTHTVHELLWGYKDEVLSLVHIFRPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFTKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPLISKDETLYIFPSDFCRSVYITFSSFENVEGLPAFRYKVPAEILANSSENAGFCIPEGNCMDAGVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKKLDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVFFGLIFTWLACRGQGSTDEGTADERAPLIRT 3EA6E653C38E3002 tsp1_human Thrombospondin-1 THBS1 TSP TSP1 Glycoprotein G protein protein human Homo sapiens Human MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP DIP protein P07996 original sequence version: 142 74749B2418E0943B scarb1-thbs1_human-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Tag GSt tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Label 125 iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte direct interaction direct interaction Fig. 2, 3, Table I scarb2-thbs1_human-1 1 11 unspecified role unspecified role bait bait human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role prey prey Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table I cd36-scarb2-1 1 3 competitor competitor competitor unspecified role unspecified role Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 11 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role bait bait Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 3, Table I cd36-scarb2-2 1 3 unspecified role unspecified role unspecified role unspecified role Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 11 unspecified role unspecified role bait bait human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role prey prey Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Table I scarb2-thbs1-1 1 5 competitor competitor competitor unspecified role unspecified role Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain synthetic construct synthetic construct 11 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 3 scarb2-thbs1_human-2 1 11 competitor competitor competitor unspecified role unspecified role human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 11 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role bait bait Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 3, Table I scarb2-thbs1_human-3 1 11 competitor competitor competitor unspecified role unspecified role human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 11 unspecified role unspecified role bait bait human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 3, Table I scarb2-scarb2-1 1 4 competitor competitor competitor unspecified role unspecified role Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role bait bait Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 3, Table I scarb2-thbs1_human-4 1 4 competitor competitor competitor unspecified role unspecified role Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role prey prey Label 125 Iodine label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 3, Table I thbs1_human Thrombospondin 1 Thrombospondin 1 complex THBS1 trimer TSP1 trimer TSP-1 trimer 5 unspecified role unspecified role direct interaction direct interaction human Homo sapiens Human stable complex stable complex biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion Secreted glycoprotein that functions during the tissue remodeling that is associated with development, wound healing, synaptogenesis, angiogenesis, and cancer. Through its interactions with proteins and proteoglycans, such as glycosaminoglycans, low density lipoprotein receptor-related protein-1, various integrins, calreticulin, and fibrinogen, TSP-1 functions at the interface of the cell membrane and the extracellular matrix to regulate matrix structure and cellular behaviour. Homotrimer created with intact-jami-dbscripts